SecReT6
Protein ID: 28872523
SecReT6 ID42
T6SS typei1
Gene symbol-
Locus tagPSPTO_5415
StrainPseudomonas syringae pv. tomato str. DC3000
Repliconchromosome [GenBank: NC_004578] [Browse all T6SS(s) in this replicon]
Location [Strand]6153553..6155589 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDQ87U92
KEGG IDpst:PSPTO_5415
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.30E-68, Aligned region: 29..326
Phage_GPD [PF05954], Evalue: 4.30E-68, Aligned region: 525..587
Phage_base_V [PF04717], Evalue: 8.00E-24, Aligned region: 375..467
DUF2345 [PF10106], Evalue: 0.00022, Aligned region: 538..572
DUF2345 [PF10106], Evalue: 0.00022, Aligned region: 578..620
Protein Sequence: 678 a.a.     [Download]
>gi|28872523|ref|NP_795142.1| unnamed protein product [Pseudomonas syringae pv. tomato str. DC3000]
MFNPSNETHFSLTVKDFSGDLQVLSFTGTEGISQPFSFDLELVSENPDIDLETLLHKQAFLAFDPQGNGI
HGQIYRVAQGDAGKRLTRYTLSLVPQLQYLHHRTNQRIYQQMSAQQIIALILEEHGIKSNGYSFQLGQPC
PARDYCVQYDETDLHFVQRLCEEEGVHYHFQHSQEGHVLVFGDDQTVFPKLSGPTAYVQGSGLVADVPVI
KGFQLRLETRTGRVTRRDYDFEKPKLQLEAAYKPANESNEPDLEDYDYPGRFVDRARGKFLSQRALERHR
ADYQQAEGWGDQTALKSGHFLPLSEHPRAEWNDLWLLTEIVHEGKQPQVLEESVTSDTTNNKDDFHHGYR
NRFLATPWAVLYRPALNHPKPRVLGSQTAVVTGPKGEEIHCDQYGRVKVQFFWDREGLADDKTSCWLRVS
SGWAGDRYGGISIPRVGMEVLVSFLEGDPDQPLVTGCLYHKENQVPYPLPTNKTRTVFKTFSSPGGGGYN
ELRIEDKKGAEQIFIHAQRDWDENIENDQKIRVGNERHDTVEKNTYTELKAEEHRTTHADRKTEVRMDDH
LTVAQNQHVKLGTAQLTSAGTEIHLKAGEKIVIEAGVELTVKAGGSFIKLDAGGITMIGPIANVNAGGSA
GTGTGIGIKPPRLPGVVDQDKAGSLMDPALVNAPPEKVEPKAVFVFSE
 
Nucleotide Sequence: 2037 bp     [Download]
>gi|28867243|ref|NC_004578.1|:c6155589-6153553 Pseudomonas syringae pv. tomato str. DC3000 chromosome, complete genome
ATGTTCAATCCTTCTAACGAAACGCACTTCAGTCTGACCGTCAAAGATTTTTCAGGCGACCTGCAAGTGT
TGTCGTTTACAGGTACTGAAGGCATCAGCCAACCGTTCAGTTTCGACCTGGAGCTGGTCAGCGAAAACCC
CGACATCGATCTGGAGACGCTTTTGCACAAGCAGGCGTTTCTGGCGTTCGATCCCCAGGGGAATGGCATC
CACGGGCAGATCTACCGCGTTGCCCAAGGCGACGCTGGCAAGCGCCTGACGCGTTACACCCTGTCTTTGG
TACCGCAGTTGCAGTACCTGCATCATCGTACCAACCAGCGTATCTATCAGCAGATGTCGGCGCAGCAAAT
CATCGCGCTGATCCTGGAAGAGCATGGCATCAAGAGTAACGGCTACAGCTTTCAGCTCGGCCAGCCATGC
CCGGCGCGCGATTACTGCGTGCAATACGATGAAACCGATCTGCACTTCGTCCAGAGGCTGTGCGAGGAAG
AGGGGGTTCACTACCACTTCCAGCACAGCCAGGAAGGGCATGTGCTGGTCTTCGGCGATGACCAAACGGT
CTTCCCCAAGCTGAGTGGGCCCACGGCGTATGTGCAAGGCAGCGGCCTGGTCGCTGACGTGCCGGTCATC
AAGGGATTCCAACTGCGTCTGGAAACCCGCACAGGCCGTGTGACCCGACGCGACTACGACTTCGAGAAGC
CGAAACTGCAACTTGAAGCCGCTTACAAACCTGCCAACGAAAGTAACGAGCCGGACCTGGAGGATTATGA
CTACCCAGGCCGCTTCGTCGATCGCGCGCGGGGCAAGTTCCTCAGCCAGCGTGCGCTGGAACGTCATCGT
GCCGATTATCAGCAAGCCGAAGGCTGGGGCGATCAGACCGCGCTCAAGAGTGGGCATTTTCTTCCGTTAT
CCGAGCACCCTCGCGCGGAGTGGAACGACTTGTGGCTGCTGACTGAAATCGTCCATGAAGGCAAACAGCC
GCAAGTGTTGGAAGAGTCGGTCACTAGCGACACCACCAACAACAAGGACGACTTCCACCACGGCTATCGC
AACCGATTCCTGGCAACCCCGTGGGCGGTTTTATATCGCCCGGCGCTGAACCACCCCAAGCCTCGGGTAC
TCGGCAGCCAAACCGCCGTGGTCACCGGCCCCAAGGGTGAAGAAATCCACTGCGACCAGTATGGCCGCGT
GAAAGTGCAGTTTTTCTGGGACCGCGAAGGCCTGGCCGATGACAAGACCAGTTGCTGGCTGCGCGTCTCC
AGCGGGTGGGCGGGCGACCGCTACGGCGGCATCAGCATCCCGCGCGTAGGTATGGAAGTGCTGGTGTCAT
TCCTTGAGGGCGACCCGGACCAACCGCTGGTGACCGGCTGCCTGTACCACAAGGAAAACCAGGTGCCGTA
CCCGCTGCCGACCAACAAGACCCGCACAGTATTCAAGACCTTCAGTTCCCCTGGCGGTGGCGGCTACAAC
GAACTGCGCATCGAAGATAAAAAAGGCGCCGAACAGATTTTCATCCATGCCCAGCGGGACTGGGACGAAA
ACATCGAAAACGACCAGAAAATCCGCGTTGGCAACGAACGCCACGACACGGTCGAAAAGAACACCTACAC
CGAGCTGAAAGCCGAAGAACACCGCACCACCCACGCCGACCGCAAGACCGAAGTCCGCATGGACGACCAC
CTGACGGTTGCGCAGAACCAGCACGTGAAACTGGGCACCGCGCAACTGACCAGCGCAGGCACCGAGATTC
ACTTGAAGGCGGGCGAAAAGATTGTTATCGAGGCGGGCGTGGAGCTCACCGTGAAGGCGGGCGGGAGCTT
CATCAAGCTCGACGCGGGCGGGATAACCATGATCGGTCCGATCGCGAACGTCAACGCTGGAGGCTCCGCC
GGAACCGGCACCGGGATTGGCATCAAGCCGCCTAGATTGCCGGGGGTTGTGGATCAGGACAAGGCGGGGA
GTTTGATGGATCCGGCGTTGGTGAATGCACCGCCTGAGAAAGTTGAACCGAAGGCTGTTTTTGTGTTTTC
TGAGTGA