SecReT6
Protein ID: 28872527
SecReT6 ID42
T6SS typei1
Gene symbol-
Locus tagPSPTO_5419
StrainPseudomonas syringae pv. tomato str. DC3000
Repliconchromosome [GenBank: NC_004578] [Browse all T6SS(s) in this replicon]
Location [Strand]6160884..6161759 [-]
Producthypothetical protein
NoteTssL
UniProt IDQ87U88
KEGG IDpst:PSPTO_5419
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.70E-70, Aligned region: 61..266
Protein Sequence: 291 a.a.     [Download]
>gi|28872527|ref|NP_795146.1| unnamed protein product [Pseudomonas syringae pv. tomato str. DC3000]
MSKDTNYSQDDKTVLLDRQGHGPAASPLTDFAAPPRFEQLEERMIYAARLRPAEAFNISLNALVAAGSDL
LSEVVRLKHSDTREDMYALNEHLTAGLKLFEVRALHNGAESSQVMAARYVLCTVVDEAVVTTPWGNESEW
SQMSLLSSFHNETFGGEKFFQLLDRLSKNPVKHLPMLELMYLCLSLGFEGKYRVQARGMLELEGIRDALY
RQIRQLRGDVPRELSPHWEGLNNRRRSLVRIVPAWMVVLFTLVCLAVMYFGFAWVLGEQRETVLQPYQPF
DPAAVQPQSQP
 
Nucleotide Sequence: 876 bp     [Download]
>gi|28867243|ref|NC_004578.1|:c6161759-6160884 Pseudomonas syringae pv. tomato str. DC3000 chromosome, complete genome
ATGAGCAAGGATACGAATTACAGTCAGGACGATAAAACCGTCCTGCTCGACCGCCAGGGCCACGGCCCGG
CGGCGAGCCCGCTGACGGACTTCGCTGCTCCGCCAAGGTTCGAGCAACTGGAAGAGCGCATGATTTACGC
GGCACGCCTGCGCCCGGCCGAGGCCTTCAACATCAGCCTCAATGCGCTGGTCGCGGCTGGCTCCGACCTT
CTTTCAGAAGTGGTACGCCTCAAGCACAGCGACACACGTGAAGACATGTATGCGCTCAACGAGCATCTGA
CTGCCGGGCTAAAGCTGTTTGAAGTCCGCGCGCTGCACAACGGTGCCGAAAGCAGCCAGGTGATGGCGGC
TCGTTACGTGCTGTGCACGGTCGTGGACGAGGCGGTTGTGACCACGCCGTGGGGCAACGAAAGCGAGTGG
TCGCAGATGAGCTTGCTCAGCAGCTTCCACAACGAAACATTTGGTGGTGAGAAGTTCTTCCAATTGCTCG
ATCGGCTGTCGAAAAACCCGGTCAAGCATTTACCGATGCTGGAATTGATGTACCTGTGTCTGTCGCTTGG
CTTCGAGGGCAAGTACCGGGTGCAGGCGCGCGGCATGCTTGAGCTTGAAGGCATCCGCGACGCTTTGTAT
CGCCAGATCCGTCAATTGCGCGGTGATGTGCCACGTGAATTGTCACCCCACTGGGAAGGCTTGAACAATC
GACGCCGCAGCCTGGTGCGCATTGTGCCTGCCTGGATGGTGGTGTTGTTTACCCTGGTCTGTCTGGCAGT
GATGTATTTCGGCTTCGCCTGGGTACTGGGCGAGCAACGCGAAACCGTTTTACAACCATATCAGCCGTTT
GATCCGGCGGCGGTCCAGCCGCAGTCACAGCCGTAA