SecReT6
Protein ID: 28872528
SecReT6 ID42
T6SS typei1
Gene symbol-
Locus tagPSPTO_5420
StrainPseudomonas syringae pv. tomato str. DC3000
Repliconchromosome [GenBank: NC_004578] [Browse all T6SS(s) in this replicon]
Location [Strand]6161765..6163096 [-]
Producthypothetical protein
NoteTssK
UniProt IDQ87U87
KEGG IDpst:PSPTO_5420
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.60E-144, Aligned region: 18..442
Protein Sequence: 443 a.a.     [Download]
>gi|28872528|ref|NP_795147.1| unnamed protein product [Pseudomonas syringae pv. tomato str. DC3000]
MKSHKVIWQEGMLLRPQHFQHNDRYYDHQMKTRTQLLGSYTWGFLSLDIDLQFLNMGKLVISHASGILPD
GSLFELGGNTEPLALDVPPNTGNTPIYLALPLVTGNHIESRRPEQSDVLARYTAYEAEVSDSNAGDDSSS
QVSCGRPDFKLLLGQQQSDQAYVKLKVCEVLDTTPDGVISLDPDFVPTYIQAHASSYLLSCLKEVISMLS
HRGDTIADRIRSNGKVGGAEVGDFMMLQLINRTELLLRHYLDLEQVHPEELYRTLLTMLGDLATFSSDSK
RPRLDSRYQHSDQGASFRKLMEAIRQVLSMVLEQHAIELVLQARQYGIIVSPLHDHKLLGSASFVLAASA
NCDSEELRHRLPAHLKVGPVERIRQLVNLHLPGIKVKPLPVAPRQIAFHTNKTYFILELSSEDLAQLERS
GGFAFHVSGEFAELELKFWAIRN
 
Nucleotide Sequence: 1332 bp     [Download]
>gi|28867243|ref|NC_004578.1|:c6163096-6161765 Pseudomonas syringae pv. tomato str. DC3000 chromosome, complete genome
ATGAAATCCCATAAAGTCATTTGGCAGGAAGGCATGTTGCTGCGCCCGCAGCACTTCCAGCACAACGATC
GCTACTACGATCACCAGATGAAAACCCGTACCCAGTTATTGGGGAGCTACACGTGGGGTTTTCTGAGTCT
GGACATCGACCTGCAGTTTCTCAATATGGGCAAACTGGTGATCAGCCATGCGTCGGGAATCCTGCCGGAT
GGCAGCCTGTTCGAGTTGGGGGGCAACACTGAGCCGCTGGCGCTCGATGTGCCGCCCAATACGGGTAATA
CTCCGATCTATCTCGCGCTGCCGCTGGTCACGGGTAACCACATTGAGTCGCGCCGCCCCGAGCAATCTGA
TGTGCTGGCGCGCTATACCGCCTACGAGGCTGAGGTGTCCGACTCCAACGCTGGCGATGACTCCTCGAGT
CAGGTCAGTTGTGGTCGTCCCGACTTCAAGCTGTTGCTTGGCCAGCAGCAAAGCGATCAGGCTTACGTGA
AGCTGAAGGTTTGCGAAGTACTCGACACGACGCCGGATGGCGTAATCAGCCTTGATCCCGATTTTGTACC
GACCTACATACAGGCTCACGCTTCCAGCTACCTGCTGTCTTGCCTCAAGGAAGTCATCAGCATGCTCAGC
CACCGGGGCGACACCATCGCTGACCGGATCCGTTCCAACGGCAAGGTAGGGGGTGCCGAAGTCGGCGACT
TCATGATGCTGCAACTGATCAACCGTACCGAGTTGCTGCTGCGTCACTATCTGGACCTTGAACAGGTGCA
CCCTGAAGAGTTGTATCGCACGCTGCTGACCATGCTTGGCGATCTGGCGACGTTTTCGAGCGATAGCAAG
AGACCGCGTCTGGACAGCCGCTACCAGCACAGCGATCAGGGAGCCAGCTTCCGCAAGCTGATGGAGGCGA
TCCGTCAGGTGCTGTCGATGGTGCTGGAACAGCACGCCATCGAACTGGTTCTACAGGCGCGTCAGTACGG
CATCATCGTATCGCCTCTGCATGATCACAAGCTGTTGGGATCGGCGTCGTTCGTTCTGGCAGCCAGCGCA
AATTGCGACTCCGAGGAACTGCGTCACCGTTTGCCAGCGCACCTCAAGGTCGGTCCTGTGGAGCGTATCC
GCCAACTGGTCAACCTTCATCTGCCTGGTATCAAGGTCAAGCCATTACCGGTGGCCCCGCGGCAGATTGC
GTTCCATACCAACAAAACCTATTTCATCCTCGAACTCAGTTCCGAAGATCTGGCGCAACTCGAGCGCTCC
GGCGGCTTCGCGTTCCATGTGTCCGGCGAATTCGCCGAGCTTGAACTGAAATTCTGGGCTATCAGGAACT
GA