SecReT6
Protein ID: 28872529
SecReT6 ID42
T6SS typei1
Gene symbol-
Locus tagPSPTO_5421
StrainPseudomonas syringae pv. tomato str. DC3000
Repliconchromosome [GenBank: NC_004578] [Browse all T6SS(s) in this replicon]
Location [Strand]6163099..6163599 [-]
Productlipoprotein
NoteTssJ
UniProt IDQ87U86
KEGG IDpst:PSPTO_5421
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.10E-43, Aligned region: 18..154
Protein Sequence: 166 a.a.     [Download]
>gi|28872529|ref|NP_795148.1| unnamed protein product [Pseudomonas syringae pv. tomato str. DC3000]
MSRRSTAFFNMLAALTALLVLAGCSTLSPYSNVTKLNLKLTASDQVNPDLNGRPSPVVVRLFELKHPVAF
ENADFFSLYERAKESLAPDMVASEELELRPGETVELKLSLQEGSRYVGVLAAYRDLPDSRWRYTLQVTPV
GITDADLTLDQNGIRNTHEPLAKADD
 
Nucleotide Sequence: 501 bp     [Download]
>gi|28867243|ref|NC_004578.1|:c6163599-6163099 Pseudomonas syringae pv. tomato str. DC3000 chromosome, complete genome
ATGTCTCGCCGCTCGACTGCTTTCTTTAACATGCTGGCTGCGCTCACCGCCTTGTTGGTGCTGGCCGGCT
GCTCTACGTTGTCGCCGTACTCAAACGTCACCAAGCTCAACCTGAAACTGACCGCCAGCGACCAGGTGAA
CCCGGACCTCAACGGTCGCCCGTCCCCCGTTGTTGTGCGCCTGTTCGAGCTCAAGCACCCGGTAGCGTTC
GAAAATGCAGATTTCTTCAGCTTGTATGAGCGCGCAAAAGAATCTCTGGCCCCGGACATGGTTGCGTCTG
AAGAGCTGGAGCTGCGTCCGGGTGAAACCGTCGAGCTCAAGCTCAGCCTGCAAGAAGGCAGTCGTTACGT
CGGCGTTCTTGCAGCCTATCGGGACCTGCCGGACAGCAGATGGCGCTACACGCTGCAGGTAACACCGGTA
GGTATCACTGACGCTGACCTGACTCTTGATCAGAACGGCATTCGTAACACCCATGAACCGCTCGCCAAGG
CAGATGACTGA