SecReT6
Protein ID: 28872530
SecReT6 ID42
T6SS typei1
Gene symbol-
Locus tagPSPTO_5422
StrainPseudomonas syringae pv. tomato str. DC3000
Repliconchromosome [GenBank: NC_004578] [Browse all T6SS(s) in this replicon]
Location [Strand]6163605..6164801 [-]
ProductFHA domain-containing protein
NoteFha
UniProt IDQ87U85
KEGG IDpst:PSPTO_5422
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 8.40E-14, Aligned region: 29..97
Protein Sequence: 398 a.a.     [Download]
>gi|28872530|ref|NP_795149.1| unnamed protein product [Pseudomonas syringae pv. tomato str. DC3000]
MELVFEMLNTKQFVPTDLCQKTFKQAGGVIGRGDDCDWIIPDRKRHLSNHHALISYRDGSFFLTDTSSNG
IQDSTNGTRLRKGEVVRIEHGSEYILGDFEIRARLVRDPAAFDVEVGRPQAAGSIIPDDAFLDLDPLNAL
DQQERVYSEIEELISPSISLDDGKQRADYARIDMESLLVPELVEVPKEPAPAPAPPPVERQADGFWEKFG
AALGVDLKGLDHDAKEALALNAARLLKQSVGGLQQSLRTRSELKNELRLAQTIVQGTQKNPLKFAVDAGE
ALDILLHANKPGQLPAEQAISRAFRDLQAHQVALLTASRAAVRGTLEHFSPQQLMLRFERDNKPLIATSG
SRWRAYGRYHQALRQDTDWSERLLTRDFAQAYEEQIRLISTLHTDHQG
 
Nucleotide Sequence: 1197 bp     [Download]
>gi|28867243|ref|NC_004578.1|:c6164801-6163605 Pseudomonas syringae pv. tomato str. DC3000 chromosome, complete genome
ATGGAACTGGTTTTCGAAATGCTGAACACCAAGCAATTCGTGCCCACTGACTTGTGCCAAAAGACCTTTA
AACAGGCTGGCGGCGTGATTGGCAGGGGAGACGATTGCGACTGGATCATCCCGGACCGCAAGCGGCACCT
GTCCAATCATCACGCGCTGATCAGCTATCGCGACGGCTCGTTTTTCCTGACCGATACCAGCAGCAACGGT
ATTCAGGACAGTACGAACGGCACGCGCCTGCGCAAGGGTGAGGTGGTACGTATCGAGCATGGCAGTGAAT
ACATTCTGGGCGATTTTGAGATTCGTGCCCGACTGGTACGCGACCCGGCAGCTTTTGACGTAGAAGTCGG
CCGCCCGCAGGCTGCAGGCAGCATTATTCCGGACGACGCGTTTCTCGATCTCGATCCGCTGAACGCCCTT
GATCAGCAAGAGCGCGTTTACTCGGAAATCGAAGAACTGATCTCACCGAGTATCTCCTTGGATGATGGCA
AGCAGCGTGCTGACTATGCACGTATCGATATGGAAAGCCTGCTGGTGCCGGAACTGGTCGAGGTTCCAAA
AGAACCTGCGCCAGCTCCAGCGCCACCACCGGTTGAGCGTCAGGCCGACGGCTTCTGGGAAAAGTTTGGT
GCAGCGCTGGGCGTTGATCTCAAAGGGCTCGATCACGATGCTAAAGAAGCGTTGGCTTTGAACGCAGCCC
GCTTGCTCAAGCAAAGCGTCGGCGGTTTGCAGCAGAGCCTGCGCACTCGCAGCGAACTCAAAAACGAGCT
GCGTCTTGCGCAGACCATCGTGCAAGGCACGCAGAAAAACCCGTTGAAGTTTGCCGTCGATGCGGGTGAG
GCGCTGGACATTCTGCTGCACGCCAACAAGCCAGGGCAGTTGCCGGCCGAGCAGGCGATCTCTCGTGCAT
TCCGTGATTTGCAGGCTCACCAGGTCGCTTTGCTGACCGCCAGCCGTGCAGCTGTTCGAGGCACCCTTGA
GCATTTCTCGCCGCAACAACTCATGCTGCGTTTCGAGCGCGATAACAAGCCGCTGATCGCCACTTCCGGC
AGCCGCTGGAGAGCTTACGGGCGTTATCACCAAGCGCTGCGCCAGGATACCGATTGGAGCGAGCGCCTTT
TGACTCGGGATTTCGCTCAGGCCTACGAAGAGCAGATTCGTTTGATTTCCACACTCCACACTGACCACCA
AGGATGA