SecReT6
Protein ID: 28872533
SecReT6 ID42
T6SS typei1
Gene symbol-
Locus tagPSPTO_5425
StrainPseudomonas syringae pv. tomato str. DC3000
Repliconchromosome [GenBank: NC_004578] [Browse all T6SS(s) in this replicon]
Location [Strand]6166575..6169223 [-]
ProductclpB protein
NoteTssH
UniProt IDQ87U82
KEGG IDpst:PSPTO_5425
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.30E-44, Aligned region: 206..284
AAA_2 [PF07724], Evalue: 2.30E-44, Aligned region: 616..781
AAA [PF00004], Evalue: 3.40E-20, Aligned region: 208..339
AAA [PF00004], Evalue: 3.40E-20, Aligned region: 621..739
AAA_5 [PF07728], Evalue: 6.10E-13, Aligned region: 208..231
AAA_5 [PF07728], Evalue: 6.10E-13, Aligned region: 470..534
AAA_5 [PF07728], Evalue: 6.10E-13, Aligned region: 620..738
ClpB_D2-small [PF10431], Evalue: 1.20E-12, Aligned region: 751..770
ClpB_D2-small [PF10431], Evalue: 1.20E-12, Aligned region: 792..860
AAA_16 [PF13191], Evalue: 3.30E-09, Aligned region: 8..94
AAA_16 [PF13191], Evalue: 3.30E-09, Aligned region: 186..230
AAA_16 [PF13191], Evalue: 3.30E-09, Aligned region: 252..286
AAA_16 [PF13191], Evalue: 3.30E-09, Aligned region: 591..657
AAA_16 [PF13191], Evalue: 3.30E-09, Aligned region: 685..714
AAA_16 [PF13191], Evalue: 3.30E-09, Aligned region: 780..810
AAA_22 [PF13401], Evalue: 2.60E-07, Aligned region: 207..294
AAA_22 [PF13401], Evalue: 2.60E-07, Aligned region: 492..517
AAA_22 [PF13401], Evalue: 2.60E-07, Aligned region: 619..714
AAA_17 [PF13207], Evalue: 6.30E-07, Aligned region: 208..267
AAA_17 [PF13207], Evalue: 6.30E-07, Aligned region: 619..655
NACHT [PF05729], Evalue: 9.50E-06, Aligned region: 208..236
NACHT [PF05729], Evalue: 9.50E-06, Aligned region: 620..645
AAA_19 [PF13245], Evalue: 1.30E-05, Aligned region: 205..231
AAA_19 [PF13245], Evalue: 1.30E-05, Aligned region: 618..642
Clp_N [PF02861], Evalue: 4.00E-05, Aligned region: 26..73
Clp_N [PF02861], Evalue: 4.00E-05, Aligned region: 102..122
IstB_IS21 [PF01695], Evalue: 0.0001, Aligned region: 202..227
IstB_IS21 [PF01695], Evalue: 0.0001, Aligned region: 620..638
IstB_IS21 [PF01695], Evalue: 0.0001, Aligned region: 732..756
IstB_IS21 [PF01695], Evalue: 0.0001, Aligned region: 810..847
Sigma54_activat [PF00158], Evalue: 0.00013, Aligned region: 203..224
Sigma54_activat [PF00158], Evalue: 0.00013, Aligned region: 620..737
AAA_18 [PF13238], Evalue: 0.00032, Aligned region: 208..231
AAA_18 [PF13238], Evalue: 0.00032, Aligned region: 621..652
AAA_29 [PF13555], Evalue: 0.00039, Aligned region: 201..225
AAA_29 [PF13555], Evalue: 0.00039, Aligned region: 618..645
DUF258 [PF03193], Evalue: 0.00049, Aligned region: 174..227
DUF258 [PF03193], Evalue: 0.00049, Aligned region: 619..633
AAA_23 [PF13476], Evalue: 0.0013, Aligned region: 208..224
AAA_23 [PF13476], Evalue: 0.0013, Aligned region: 440..491
AAA_23 [PF13476], Evalue: 0.0013, Aligned region: 618..650
Arch_ATPase [PF01637], Evalue: 0.003, Aligned region: 188..227
Arch_ATPase [PF01637], Evalue: 0.003, Aligned region: 260..294
Arch_ATPase [PF01637], Evalue: 0.003, Aligned region: 619..632
AAA_25 [PF13481], Evalue: 0.0034, Aligned region: 208..232
AAA_25 [PF13481], Evalue: 0.0034, Aligned region: 264..303
AAA_25 [PF13481], Evalue: 0.0034, Aligned region: 474..492
AAA_25 [PF13481], Evalue: 0.0034, Aligned region: 618..649
TIP49 [PF06068], Evalue: 0.0036, Aligned region: 208..247
TIP49 [PF06068], Evalue: 0.0036, Aligned region: 256..288
TIP49 [PF06068], Evalue: 0.0036, Aligned region: 620..655
Zeta_toxin [PF06414], Evalue: 0.0057, Aligned region: 206..229
Zeta_toxin [PF06414], Evalue: 0.0057, Aligned region: 619..660
Protein Sequence: 882 a.a.     [Download]
>gi|28872533|ref|NP_795152.1| unnamed protein product [Pseudomonas syringae pv. tomato str. DC3000]
MSNVDLQQLIQALDAETRRDLESSAERCVARGGSKILVEDLLLELLERPQGLLARALQDAEVDAGELSAS
LQSRVEHSASRNPVFAPELVQWLQDALLVANLELGQTQVEQAALILALLRNPMRYAGSRYQPLLAKLNID
RLKEFALSKQEQPANGKSAAQGESLLERFTHNLTQQARDGKLDPVLCRDGAIRQMVDILARRRKNNPIVV
GEAGVGKTAIVEGLASRIAAGEVPQALKGVELLSLDMGLLQAGASVKGEFERRLKGVIDEVKASPKPIIL
FIDEAHTLIGAGGNAGGSDAANLLKPALARGELRTIAATTWAEYKKYFEKDPALARRFQPVQLHEPTVSE
AVTILRGLAQVYEKSHGIYLRDDAVVAAAELSARYLAGRQLPDKAVDVLDTACARVRISLAAAPESLERL
RGELAEGGRQRQALRRDAEAGLLIDHESLEALETRLHAAEEERVALEAMWLEQKTLAERLLELRQQLAKA
REAVAAVPVVEIGEDDEGTVIEAVALDETQSVEALTAALNDTHVALAALQVKERLVSFEVCPRLVAEVIS
AWTGVPLAQLAREHNAKVASFAKDLRIRIRGQEQAVHALDRSMRATAAGLNKPDAPVGVFLLVGPSGVGK
TETALALADLLYGGDRFITTINMSEFQEKHTVSRLIGAPPGYVGYGEGGMLTEAVRQKPYSVVLLDEVEK
ADPDVLNLFYQIFDKGVANDGEGREIDFRNTLILMTSNLGSDQISALCEDGARPTAEVLEETIRPVLSKH
FKPALLARMRVVPYYPVSGPVLRELIEIKLGRLGERLNRRQLEFTYCQDLVDHLAQRCTQSDSGARLIDH
LLDLHVLPLVADRLLDAMATGESLKRVHATLDTSGTVTCEFA
 
Nucleotide Sequence: 2649 bp     [Download]
>gi|28867243|ref|NC_004578.1|:c6169223-6166575 Pseudomonas syringae pv. tomato str. DC3000 chromosome, complete genome
ATGAGCAATGTAGACCTGCAACAACTTATTCAAGCGCTGGACGCCGAAACCCGTCGTGATCTGGAAAGCT
CCGCGGAGCGCTGCGTAGCCCGGGGCGGTAGCAAGATTCTGGTTGAAGATCTGTTGCTGGAGCTGCTGGA
GCGTCCGCAAGGTCTGCTCGCGCGTGCCCTGCAGGATGCTGAAGTGGACGCTGGTGAATTGAGTGCCTCT
CTGCAATCGCGGGTCGAGCACAGCGCTTCACGCAACCCGGTGTTTGCTCCGGAACTGGTGCAATGGCTGC
AGGATGCCTTGCTGGTGGCCAACCTTGAACTGGGTCAGACCCAGGTCGAACAGGCCGCGCTGATCCTCGC
ACTACTGCGCAACCCGATGCGCTACGCCGGTAGCCGCTATCAGCCTTTGCTGGCCAAACTGAATATTGAT
CGGCTGAAAGAGTTTGCTCTGTCCAAGCAAGAGCAGCCTGCCAACGGCAAATCGGCTGCTCAGGGCGAAT
CGCTGTTGGAGCGTTTCACTCACAACCTGACCCAGCAGGCCCGCGACGGCAAGCTTGATCCGGTACTGTG
CCGCGATGGCGCGATTCGGCAAATGGTCGACATCCTGGCTCGGCGCCGCAAGAACAATCCGATTGTGGTC
GGCGAAGCCGGTGTCGGTAAAACCGCCATCGTTGAAGGTCTCGCATCCCGAATTGCTGCGGGTGAAGTGC
CGCAGGCGCTCAAGGGCGTCGAGCTGCTGTCGCTGGACATGGGGCTGCTGCAGGCTGGCGCCAGCGTAAA
GGGTGAGTTCGAGCGTCGCCTCAAAGGTGTGATCGACGAAGTCAAAGCGTCGCCTAAGCCGATCATTCTG
TTCATCGATGAAGCCCACACGCTTATCGGTGCTGGCGGCAACGCTGGTGGTTCCGATGCCGCCAACCTGC
TCAAGCCGGCTCTGGCGCGTGGCGAGTTGCGCACCATCGCTGCCACGACGTGGGCTGAGTACAAGAAGTA
CTTTGAAAAAGACCCGGCTCTGGCGCGTCGCTTCCAGCCTGTTCAACTGCATGAACCGACCGTAAGCGAA
GCCGTGACCATCCTGCGTGGTCTGGCACAAGTCTATGAGAAGAGCCATGGCATTTACTTGCGCGACGACG
CTGTGGTTGCTGCCGCCGAGCTGTCTGCCCGCTATCTGGCTGGCCGCCAGCTTCCTGACAAAGCAGTCGA
TGTTCTCGATACGGCGTGCGCGCGCGTGCGTATCAGCCTGGCTGCCGCGCCGGAGAGTCTGGAGCGCCTG
CGTGGCGAGCTGGCTGAAGGTGGTCGCCAGCGTCAGGCATTGCGTCGCGACGCTGAAGCCGGTCTGCTGA
TTGACCACGAGTCGCTGGAAGCTCTGGAAACGCGTCTGCACGCAGCTGAAGAGGAAAGGGTTGCACTGGA
AGCAATGTGGCTCGAACAGAAAACATTGGCCGAACGCTTGCTGGAACTGCGTCAGCAACTGGCCAAGGCG
CGTGAAGCGGTAGCTGCCGTGCCAGTCGTTGAAATCGGAGAGGACGACGAGGGCACGGTCATCGAAGCCG
TTGCGCTGGATGAAACGCAGAGCGTAGAGGCGCTGACAGCAGCCCTGAACGATACCCATGTCGCCCTGGC
CGCACTGCAGGTCAAGGAGCGACTGGTGAGCTTCGAGGTCTGTCCGCGTCTTGTGGCTGAGGTGATCAGC
GCCTGGACCGGTGTCCCGCTGGCGCAACTGGCTCGTGAGCACAACGCCAAGGTTGCCAGTTTCGCCAAGG
ACCTTCGTATTCGCATCCGTGGTCAAGAGCAGGCCGTTCATGCCCTTGATCGCTCCATGCGCGCTACTGC
CGCTGGCTTGAACAAACCCGATGCGCCGGTAGGCGTGTTTCTGCTTGTGGGGCCGAGCGGCGTTGGCAAG
ACTGAAACGGCGCTGGCGCTCGCTGATCTGTTGTACGGAGGTGATCGTTTTATCACCACCATCAACATGT
CCGAGTTTCAGGAGAAGCATACGGTTTCGCGCCTGATCGGTGCGCCGCCAGGTTACGTCGGTTATGGCGA
AGGCGGCATGCTCACCGAAGCTGTACGTCAGAAGCCGTATTCGGTCGTGCTGCTTGATGAAGTCGAGAAA
GCCGACCCTGATGTGCTCAACCTGTTCTATCAGATCTTCGACAAAGGTGTGGCCAACGACGGCGAGGGAC
GCGAGATCGACTTCCGCAATACGCTGATTCTGATGACATCGAACCTTGGCAGCGACCAGATCAGCGCACT
GTGCGAAGACGGCGCGCGGCCAACCGCCGAAGTGCTTGAGGAGACCATCCGGCCGGTCCTCAGCAAACAC
TTCAAGCCAGCGTTACTGGCACGTATGCGCGTAGTGCCGTACTACCCGGTCAGCGGGCCGGTGCTACGCG
AGCTGATCGAAATCAAACTCGGTCGCCTGGGCGAGCGCCTGAACCGTCGTCAGCTGGAATTCACTTACTG
TCAGGACCTCGTTGATCACTTGGCGCAGCGTTGCACTCAAAGCGACAGCGGTGCGCGTCTGATCGACCAT
CTGCTGGACCTTCATGTCCTGCCGCTGGTAGCTGACCGCCTGCTCGATGCTATGGCTACCGGAGAAAGTC
TGAAGCGTGTTCATGCCACGCTGGACACTTCCGGCACCGTGACGTGTGAGTTTGCCTGA