SecReT6
Protein ID: 28872535
SecReT6 ID42
T6SS typei1
Gene symbol-
Locus tagPSPTO_5427
StrainPseudomonas syringae pv. tomato str. DC3000
Repliconchromosome [GenBank: NC_004578] [Browse all T6SS(s) in this replicon]
Location [Strand]6170208..6171761 [-]
Producthypothetical protein
NoteTssF
UniProt IDQ87U80
KEGG IDpst:PSPTO_5427
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.40E-142, Aligned region: 1..517
Protein Sequence: 517 a.a.     [Download]
>gi|28872535|ref|NP_795154.1| unnamed protein product [Pseudomonas syringae pv. tomato str. DC3000]
MRPLPAFSILQFDPLKRSGPALTVERDTPVDSKPINDVRCRFRTCYPTEVQALDLTALNYSVKGGGSLLS
LRLEMSAEGHLGELELSRLRLHFAGERYISQMLYLCLLRNLEGIELIPLDAAGKPIDGVNGAPMAFKMPG
DRVQPVGFAEEEALIPYPLNTFRGYRYLQEYFAFQDKFLFVDINGLDLLNALPEETLKQVRGLELRFDIR
KSGIQRLRPTLDNVKLYCTPIVNLFKHDALPIRLDGKQDEYLLLPAEYGLETCGVFSVETVTGWKPGGLG
YQDYVPFESFEHDPSFDVPNSRPHYSIRQRSSLLHEGLDTYLSFGIRHTEAHETLSIELMCTNQNLPRKL
KLGEINVACEDTPEFLSFRNITPATSSFAPPLNRDFLWKLISNMSLNYLSLADVNALKVILETYDLPRYY
DQHAEKVSKRLLGGLKSIKHQHVDRLHRGLPVRGLRTELTIDPEGYIGEGDMFVFASVLNEFFALYASLN
SYHELRVKSTQGEVYQWTPRMGLQPLL
 
Nucleotide Sequence: 1554 bp     [Download]
>gi|28867243|ref|NC_004578.1|:c6171761-6170208 Pseudomonas syringae pv. tomato str. DC3000 chromosome, complete genome
ATGCGGCCGTTGCCTGCGTTCAGTATTTTGCAGTTTGATCCGTTGAAACGTTCGGGTCCTGCGCTGACGG
TCGAACGTGATACACCGGTCGATAGCAAGCCTATTAATGACGTGCGTTGTCGCTTCCGTACGTGCTACCC
GACCGAAGTTCAGGCGCTGGATCTGACCGCGCTGAATTACTCGGTGAAAGGCGGTGGTTCGTTGCTCAGC
CTGCGCCTGGAGATGAGCGCTGAAGGTCACTTGGGTGAGCTTGAACTGAGCCGCCTGCGTCTGCACTTTG
CAGGCGAGCGCTATATCAGCCAGATGCTGTACCTCTGCCTGCTACGCAATCTCGAGGGTATCGAGCTGAT
CCCTCTGGACGCTGCCGGCAAGCCCATCGACGGTGTCAATGGCGCGCCAATGGCGTTCAAGATGCCGGGC
GACCGTGTACAGCCGGTAGGGTTTGCCGAAGAAGAGGCGTTGATCCCGTATCCGCTGAACACGTTCCGCG
GTTATCGCTACCTGCAGGAGTACTTCGCGTTTCAGGACAAGTTCCTGTTCGTCGACATCAACGGTCTGGA
TCTGCTCAACGCACTGCCAGAAGAGACACTCAAACAAGTGCGCGGCCTTGAGTTGCGCTTTGATATTCGC
AAGAGCGGCATTCAGCGTCTTCGTCCCACCCTGGATAACGTAAAGCTGTATTGCACGCCGATCGTCAACT
TGTTCAAGCACGACGCCTTGCCGATTCGCCTTGATGGCAAGCAGGACGAGTACCTGCTGCTGCCCGCCGA
ATATGGCCTGGAAACCTGTGGTGTGTTTTCGGTTGAAACCGTGACCGGTTGGAAGCCGGGAGGTCTTGGC
TATCAGGATTATGTGCCGTTCGAATCCTTTGAGCACGACCCCAGTTTCGACGTGCCCAACAGCCGTCCGC
ATTACAGCATTCGCCAGCGTTCTTCTTTGCTCCATGAAGGCCTCGACACTTATCTGAGTTTCGGCATTCG
CCATACAGAAGCGCACGAAACCCTGTCGATCGAGTTGATGTGCACCAATCAGAACCTGCCACGCAAACTC
AAACTGGGCGAAATCAACGTGGCCTGCGAAGATACGCCGGAGTTTTTGAGTTTCCGCAATATCACACCGG
CTACCTCCAGTTTCGCGCCCCCGCTGAACCGTGACTTCCTGTGGAAGTTGATCAGCAATATGTCGCTCAA
TTACTTGTCTCTGGCTGACGTCAATGCGCTGAAGGTGATTCTGGAAACCTACGATTTGCCCCGTTACTAC
GACCAGCACGCGGAAAAAGTCAGCAAGCGCCTGTTGGGCGGTTTGAAATCGATCAAGCATCAACACGTGG
ACAGATTGCACCGAGGGTTACCGGTACGCGGATTGCGCACTGAGCTGACCATCGACCCGGAAGGGTATAT
CGGCGAAGGCGACATGTTTGTATTCGCTTCGGTTCTCAACGAGTTTTTCGCGCTTTACGCCAGTCTCAAT
TCGTACCACGAGCTGCGGGTAAAAAGCACACAGGGAGAGGTGTACCAATGGACACCACGTATGGGCCTCC
AGCCCCTGCTTTAA