SecReT6
Protein ID: 28872540
SecReT6 ID42
T6SS typei1
Gene symbol-
Locus tagPSPTO_5432
StrainPseudomonas syringae pv. tomato str. DC3000
Repliconchromosome [GenBank: NC_004578] [Browse all T6SS(s) in this replicon]
Location [Strand]6176718..6178196 [-]
Producthypothetical protein
NoteTssC
UniProt IDQ87U76
KEGG IDpst:PSPTO_5432
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 4.50E-192, Aligned region: 65..490
Protein Sequence: 492 a.a.     [Download]
>gi|28872540|ref|NP_795159.1| unnamed protein product [Pseudomonas syringae pv. tomato str. DC3000]
MPSNSSAKQKSVETSEHSILDSIIAQTSLTRDDEAYDIAKRGVSAFIEELLKPQNNGEPVKKAMVDRMIA
EIDAKLSRQMDEILHHPDFQSLESSWRGLQLLVDRTNFRENIKIEILNVSKDDLLEDFEDSPEVMQSGLY
KHIYTAEYGQFGGQPVGAIIANYFMSPSSPDVKLMQYVSSVACMSHAPFIAAAGPKFFGLESFTGLPDLK
DLKDHFEGPQFAKWQSFRQSEDSRYVGLTVPRFLLRNPYDPQENPVKSFVYKETVANSHEHYLWGNTAYA
FGTKLTDSFAKFRWCPNIIGPQSGGAVEDLPLHHFESMGEIETKIPTEVLVSDRREYELAEEGFISLTMR
KGSDNAAFFSASSVQKPKFFGNSAEGKAAELNYKLGTQLPYMMIVNRLAHYLKVLQREQLGSWKERTDLE
LELNKWIRQYVADQENPSAEVRGRRPLRAAQITVSDVEGEPGWYRVSLNVRPHFKYMGADFTLSLVGKLD
KE
 
Nucleotide Sequence: 1479 bp     [Download]
>gi|28867243|ref|NC_004578.1|:c6178196-6176718 Pseudomonas syringae pv. tomato str. DC3000 chromosome, complete genome
ATGCCAAGCAATAGCTCAGCAAAGCAAAAAAGCGTTGAGACAAGCGAACACAGTATTCTCGACAGCATCA
TTGCCCAGACCAGTCTGACGCGTGACGACGAAGCCTATGACATCGCCAAGCGTGGCGTATCGGCCTTCAT
TGAAGAGCTGCTAAAGCCGCAGAACAACGGTGAGCCGGTCAAGAAGGCAATGGTCGACCGCATGATCGCC
GAGATCGATGCCAAGCTCAGCCGCCAGATGGACGAAATCCTGCACCACCCAGACTTCCAGTCCCTGGAAT
CGTCGTGGCGTGGCCTGCAGTTGTTGGTCGATCGCACCAACTTCCGTGAAAACATCAAGATCGAAATCCT
CAACGTCTCCAAAGATGATTTGCTGGAAGACTTCGAAGACTCGCCGGAAGTGATGCAGTCGGGCCTGTAC
AAGCACATCTACACCGCAGAATACGGCCAGTTCGGTGGTCAGCCAGTGGGCGCGATCATCGCCAACTACT
TCATGTCTCCAAGCTCGCCTGACGTGAAACTCATGCAGTACGTATCTAGCGTAGCCTGCATGTCTCATGC
ACCGTTCATTGCTGCTGCCGGCCCGAAATTCTTCGGTCTGGAGAGCTTCACTGGCTTGCCGGACCTGAAA
GATCTGAAGGATCACTTCGAAGGCCCGCAGTTCGCAAAATGGCAGAGCTTCCGCCAGTCGGAAGATTCCC
GTTACGTCGGCCTGACCGTTCCGCGCTTCTTGCTGCGCAATCCGTACGACCCGCAGGAAAACCCCGTCAA
GTCATTCGTGTACAAGGAAACCGTCGCCAACAGCCACGAGCATTATCTGTGGGGCAACACGGCTTACGCG
TTCGGCACCAAGCTGACCGACAGTTTCGCCAAGTTCCGCTGGTGCCCGAACATCATCGGCCCGCAGAGCG
GCGGTGCAGTTGAAGACCTGCCGTTGCACCATTTCGAAAGCATGGGCGAAATCGAGACCAAGATCCCTAC
CGAGGTTCTGGTCAGCGACCGTCGTGAATACGAACTGGCTGAGGAAGGCTTCATCTCCCTGACCATGCGT
AAGGGCAGCGACAACGCGGCGTTCTTCTCCGCCAGTTCCGTGCAGAAGCCGAAGTTCTTCGGTAACAGCG
CTGAAGGCAAGGCTGCAGAGCTGAACTACAAGCTGGGCACCCAGCTGCCGTACATGATGATCGTCAACCG
CCTGGCTCACTACTTGAAAGTGCTGCAGCGCGAGCAACTCGGTTCGTGGAAAGAGCGTACCGATCTCGAG
CTGGAACTGAACAAGTGGATCCGCCAGTACGTCGCAGATCAGGAGAACCCGAGCGCCGAAGTGCGCGGCC
GTCGCCCGTTGCGCGCTGCCCAGATTACCGTCAGCGACGTCGAAGGTGAACCTGGCTGGTACCGCGTCAG
CCTGAACGTGCGCCCGCACTTCAAATACATGGGTGCTGATTTCACCCTGTCGCTGGTTGGCAAGCTGGAC
AAAGAGTAA