SecReT6
Protein ID: 28872541
SecReT6 ID42
T6SS typei1
Gene symbol-
Locus tagPSPTO_5433
StrainPseudomonas syringae pv. tomato str. DC3000
Repliconchromosome [GenBank: NC_004578] [Browse all T6SS(s) in this replicon]
Location [Strand]6178225..6178731 [-]
Producthypothetical protein
NoteTssB
UniProt IDQ87U75
KEGG IDpst:PSPTO_5433
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 7.90E-53, Aligned region: 5..160
Protein Sequence: 168 a.a.     [Download]
>gi|28872541|ref|NP_795160.1| unnamed protein product [Pseudomonas syringae pv. tomato str. DC3000]
MAKEGSVAPKERINVTFKPATGGNQEEIELPLKLLAIGDYTHRRDERKVEDRKPISIDKTTFDEVLAKQE
LELTLSVPNRLQDEEGVAEELPVKLRVNSMKDFNPASLVEQVPELKKLMELRDALVALKGPLGNAPAFRK
AIEGVLADDESRGRVLGELGLKAPAPDA
 
Nucleotide Sequence: 507 bp     [Download]
>gi|28867243|ref|NC_004578.1|:c6178731-6178225 Pseudomonas syringae pv. tomato str. DC3000 chromosome, complete genome
ATGGCCAAAGAAGGCTCTGTAGCCCCCAAGGAACGCATCAACGTCACTTTTAAACCCGCTACCGGCGGTA
ATCAGGAAGAGATCGAGTTGCCGCTGAAGTTGTTGGCAATCGGTGATTACACCCATCGCAGGGACGAGCG
CAAAGTTGAAGATCGCAAGCCGATCAGCATCGACAAGACGACCTTCGACGAAGTGTTGGCCAAGCAAGAG
CTTGAACTGACACTTAGCGTGCCGAACCGCCTTCAGGACGAAGAAGGCGTAGCGGAAGAGCTGCCCGTGA
AACTGCGTGTCAACTCGATGAAAGACTTCAACCCGGCCAGCCTGGTTGAACAGGTTCCCGAGCTGAAAAA
ACTGATGGAACTGCGTGATGCGTTGGTGGCGCTCAAAGGCCCGCTGGGTAACGCGCCTGCGTTCCGCAAA
GCTATCGAAGGCGTTCTTGCCGACGACGAATCCCGCGGTCGCGTACTGGGTGAACTGGGCCTGAAAGCCC
CAGCCCCGGACGCTTGA