SecReT6
Protein ID: 28872542
SecReT6 ID42
T6SS typei1
Gene symbol-
Locus tagPSPTO_5434
StrainPseudomonas syringae pv. tomato str. DC3000
Repliconchromosome [GenBank: NC_004578] [Browse all T6SS(s) in this replicon]
Location [Strand]6178764..6180320 [-]
Producthypothetical protein
NoteTssA
UniProt IDQ87U74
KEGG IDpst:PSPTO_5434
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.70E-23, Aligned region: 55..115
Protein Sequence: 518 a.a.     [Download]
>gi|28872542|ref|NP_795161.1| unnamed protein product [Pseudomonas syringae pv. tomato str. DC3000]
MSYSSKLSAHYLELAKAPVSPASFAGDDVRFSVEFESLESELGKAQSMHEAGQIDWLKIRENSESLLRTQ
SKDLRVGVWLAWALYQRESFQGLLAGLGVLHHLCEQHWADIHPKKARTRAAAIGWLVPRLEQVLNENVAL
KEQLPMFRRLVEHLEGLDKACTEHLGDDAPLLLPISRRLKSMVQRAADNQPEPGVVGAAVAQVKQAATQL
FTPGAPIDNEKEAHKALRAQQENARPLCAWWLKQKASDLRALRLNRTLLWLPIDAVPERNAEQITALRGL
PADKLKAYRDRYEQAKYADLLVELEASLAKAPFWFDGQRMVWECLQGLNAEMAMREVEIHFALLIQRLPG
IIELRYHDGTPFADPATRAWISASVLPHLQTNNAPRKVEVTDTQPAWEVALEAALLVLRKEGLKAAVQFL
KQGLQKAQGGRARFFWQFALARLCFVAKKYELAKAQLETLDQTLQESGLHAWEPDLALEVLHLLHSCCEL
LPQNQVVRERKEEIYRRLCHLDLEVVLE
 
Nucleotide Sequence: 1557 bp     [Download]
>gi|28867243|ref|NC_004578.1|:c6180320-6178764 Pseudomonas syringae pv. tomato str. DC3000 chromosome, complete genome
ATGTCCTACTCAAGCAAACTTTCTGCTCACTACCTGGAACTCGCCAAGGCCCCTGTTTCGCCTGCTAGTT
TTGCGGGCGATGACGTTCGTTTTTCGGTCGAGTTCGAGTCGCTGGAAAGCGAGTTGGGTAAAGCCCAGTC
CATGCATGAAGCAGGGCAGATCGACTGGCTTAAAATCCGTGAAAACAGTGAGAGCCTGCTTCGCACCCAG
TCCAAGGACTTGCGGGTAGGTGTCTGGCTTGCATGGGCGCTTTATCAGCGAGAGTCCTTCCAGGGCCTGT
TGGCCGGTCTCGGTGTTTTGCACCATCTTTGCGAGCAGCACTGGGCTGACATTCACCCGAAAAAGGCCCG
CACGCGCGCCGCTGCCATTGGCTGGCTGGTGCCGCGTCTCGAGCAGGTGCTGAACGAAAACGTCGCGCTC
AAGGAGCAGTTGCCAATGTTCCGGCGTCTGGTCGAACACCTTGAAGGCCTCGATAAAGCGTGCACCGAAC
ATTTGGGCGACGACGCACCTTTGCTACTGCCGATCTCCCGCCGTCTGAAAAGCATGGTCCAGCGCGCTGC
TGACAACCAGCCCGAGCCTGGTGTAGTCGGCGCAGCGGTTGCGCAGGTCAAGCAGGCTGCCACACAACTC
TTCACGCCTGGTGCGCCTATCGATAACGAAAAGGAAGCGCACAAGGCCCTGCGCGCCCAGCAGGAAAACG
CGCGCCCTTTATGTGCATGGTGGCTTAAACAGAAAGCCAGCGATCTGCGAGCCTTGCGGCTTAATCGCAC
ACTGCTGTGGCTGCCGATCGATGCTGTTCCGGAGCGTAACGCCGAGCAAATCACTGCCCTGCGAGGCCTG
CCGGCAGACAAACTCAAGGCTTATCGGGATCGCTACGAGCAGGCCAAATATGCCGATCTCTTGGTCGAGC
TGGAAGCGAGCCTGGCGAAGGCGCCTTTCTGGTTCGACGGCCAGCGAATGGTATGGGAATGCCTGCAAGG
CCTGAACGCAGAGATGGCGATGCGTGAAGTGGAAATCCACTTCGCGCTTTTGATTCAGCGCCTGCCCGGC
ATCATCGAATTGCGCTATCACGATGGAACGCCGTTCGCCGACCCGGCGACGCGTGCCTGGATCAGCGCAA
GCGTCTTGCCGCATCTGCAAACCAACAACGCACCGCGCAAGGTGGAAGTTACCGATACCCAGCCAGCCTG
GGAAGTGGCCCTTGAAGCGGCGTTGCTCGTCCTGCGCAAAGAGGGCTTGAAAGCCGCTGTGCAGTTCCTC
AAGCAAGGGCTGCAAAAGGCGCAGGGCGGACGCGCTCGATTTTTCTGGCAGTTCGCTCTCGCCCGACTGT
GCTTCGTGGCCAAAAAATACGAACTGGCCAAGGCGCAACTCGAGACGCTGGATCAGACATTACAGGAGTC
GGGCCTGCATGCATGGGAGCCCGATCTTGCGCTGGAAGTGCTGCATCTGCTGCATAGCTGCTGTGAGCTG
CTACCACAGAACCAAGTGGTGCGCGAACGCAAGGAAGAGATTTATCGCAGGCTGTGCCACCTAGACCTCG
AAGTGGTACTCGAATAG