SecReT6
Protein ID: 28872543
SecReT6 ID42
T6SS typei1
Gene symbolhcp-2
Locus tagPSPTO_5435
StrainPseudomonas syringae pv. tomato str. DC3000
Repliconchromosome [GenBank: NC_004578] [Browse all T6SS(s) in this replicon]
Location [Strand]6181106..6181624 [+]
Productsecreted protein Hcp
NoteTssD
UniProt IDQ87U73
KEGG IDpst:PSPTO_5435
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.10E-41, Aligned region: 6..156
Protein Sequence: 172 a.a.     [Download]
>gi|28872543|ref|NP_795162.1| hcp-2 gene product [Pseudomonas syringae pv. tomato str. DC3000]
MATPAYMSITGTKQGLITAGAFTADSVGNTYQEGHEDQVMVQGFSHELIIPRDPQSGQPTGQRVHKPVKI
TKVFDKSSPLLLAALTSGERLTEITIQWYRTSAAGTQEHYYTTKLEDAIIVDIKDYMHNCQDPANAHFTH
LEDVEFTYRKITWTHEVSGTSGSDDWRSPVAG
 
Nucleotide Sequence: 519 bp     [Download]
>gi|28867243|ref|NC_004578.1|:6181106-6181624 Pseudomonas syringae pv. tomato str. DC3000 chromosome, complete genome
ATGGCTACGCCAGCGTACATGTCCATCACCGGCACCAAACAAGGCCTGATCACCGCCGGTGCCTTCACTG
CTGACTCGGTCGGCAACACCTACCAGGAAGGTCACGAAGACCAAGTGATGGTTCAGGGCTTCAGCCACGA
ACTCATCATCCCGCGTGACCCGCAGTCGGGCCAACCTACCGGTCAGCGCGTCCACAAGCCGGTCAAGATC
ACCAAAGTGTTCGACAAGTCCTCGCCTCTGCTGCTGGCAGCACTGACCTCTGGCGAGCGTCTGACCGAAA
TCACCATCCAGTGGTACCGCACCTCGGCTGCCGGCACTCAAGAGCACTACTACACCACCAAGCTTGAAGA
CGCGATCATCGTTGACATCAAGGACTACATGCACAATTGCCAAGACCCGGCGAACGCGCATTTCACCCAT
TTGGAAGACGTAGAATTCACCTACCGCAAAATCACTTGGACCCACGAAGTATCCGGTACTTCGGGTTCCG
ATGACTGGCGTTCCCCGGTCGCTGGCTAA