SecReT6
Protein ID: 28872544
SecReT6 ID42
T6SS typei1
Gene symbol-
Locus tagPSPTO_5436
StrainPseudomonas syringae pv. tomato str. DC3000
Repliconchromosome [GenBank: NC_004578] [Browse all T6SS(s) in this replicon]
Location [Strand]6181756..6183798 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDQ87U72
KEGG IDpst:PSPTO_5436
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 9.70E-69, Aligned region: 29..322
Phage_GPD [PF05954], Evalue: 9.70E-69, Aligned region: 527..581
Phage_base_V [PF04717], Evalue: 6.00E-24, Aligned region: 371..463
DUF2345 [PF10106], Evalue: 2.40E-06, Aligned region: 535..571
DUF2345 [PF10106], Evalue: 2.40E-06, Aligned region: 574..616
Protein Sequence: 680 a.a.     [Download]
>gi|28872544|ref|NP_795163.1| unnamed protein product [Pseudomonas syringae pv. tomato str. DC3000]
MFAPANQTHFSLTIEGLSNDLQVLALQGREAISQPFAFEVDLVSEQPSLDLETLLHKPAFLQLSPDGSGI
HGQIYRASQGDSGKRLTRYAVTLRPQLAYLAHRTNQRIFQNLTVPKIIGIVLEEHGIQGNAYEFKVGSIY
PERIYCVQYDESDLHFVQRLCEEEGIHYHFQHSTNGHTLVFGDDQTVFPKLAPVAYQQDSGMVATDPVVK
RFDLRMETRTSRTTRRDYDFEKPRLTLESENRGDAIPDLEDYDYPGRFVDRERGKQLAKRALERHRSDYQ
LAVGKSDQPLLVSGHFLALTQHPKAKWNDLWLLTEILHEGKQPQVLEESVTSDTTDLKDDFHQGYRNRFQ
ATPWDVPNRPPLTHPKPRILGSQSAVVTGPKGEEIHCDQYGRVKVQFPWDREGQSDDKTSCWLRVSSAWA
GAMYGGIAIPRIGMEVLVTFLEGDPDQPLISGCLYHKENVVPYDLPANKTRSTFKSMSSPGGGGFNELRI
EDKKGQEQIFLHAQRDWDENVENDQKIRVGNERHDTVEQNSHSEFKAEEHHTVYADRKVEARADDHLTVG
ANQHVKVGTGQFIEAGQEIHLSSGVKVVLEAGSELTLKAGGSFIKIDASGVTLSGPFIHVNDGGSPGNGT
PAAPLMPGPLLQADADKAGAALTPAQINTLKRNAPFCEECEKCKDGACAI
 
Nucleotide Sequence: 2043 bp     [Download]
>gi|28867243|ref|NC_004578.1|:6181756-6183798 Pseudomonas syringae pv. tomato str. DC3000 chromosome, complete genome
ATGTTCGCGCCGGCCAATCAGACTCACTTTTCCCTGACCATAGAAGGTCTTTCCAATGATCTGCAGGTTC
TTGCCTTGCAAGGTCGGGAAGCCATCAGCCAGCCTTTTGCGTTTGAGGTCGATCTGGTCAGTGAGCAGCC
ATCCCTGGACCTCGAAACGCTGCTACATAAACCGGCCTTTCTGCAGCTCTCGCCTGACGGCAGCGGCATT
CATGGCCAGATTTACCGCGCCTCACAGGGCGACTCGGGCAAGCGGCTAACCCGCTACGCCGTGACCTTAC
GCCCGCAACTGGCCTACCTTGCCCACCGTACCAACCAGCGTATCTTCCAGAACCTCACCGTCCCGAAAAT
CATCGGTATTGTTCTCGAAGAGCACGGCATTCAAGGCAACGCCTACGAATTCAAAGTCGGGTCGATTTAT
CCTGAACGCATCTACTGCGTTCAATACGATGAATCGGATCTGCACTTCGTCCAACGGCTGTGCGAGGAAG
AAGGTATCCACTACCATTTCCAGCACAGCACCAACGGCCACACACTGGTGTTCGGCGATGACCAGACGGT
GTTCCCGAAACTTGCACCAGTGGCCTACCAGCAAGACTCAGGCATGGTCGCCACCGATCCGGTGGTAAAG
CGATTCGACCTGCGCATGGAAACCCGCACTAGCCGCACGACACGCCGCGACTACGACTTCGAGAAACCGC
GCCTGACGCTGGAAAGCGAAAACCGGGGCGATGCCATCCCCGACCTTGAAGACTACGACTACCCTGGCCG
CTTCGTGGATCGCGAACGCGGCAAGCAACTGGCCAAAAGAGCACTGGAACGTCATCGCAGCGACTACCAA
CTGGCCGTAGGCAAGAGCGATCAGCCGCTGCTGGTCAGCGGCCACTTTCTGGCGCTGACCCAGCACCCCA
AAGCCAAATGGAACGATCTGTGGCTGCTGACCGAAATCCTGCACGAAGGCAAACAGCCGCAGGTGCTGGA
GGAGTCGGTCACCAGCGACACAACCGACCTGAAGGATGATTTCCATCAGGGCTACCGCAACCGCTTCCAG
GCCACCCCGTGGGACGTGCCCAACCGTCCGCCGCTGACCCACCCCAAACCGCGCATTCTCGGCAGCCAAA
GTGCCGTGGTCACCGGCCCCAAAGGCGAAGAAATCCACTGCGATCAGTACGGCCGCGTCAAAGTGCAGTT
CCCCTGGGACCGCGAAGGCCAGTCCGACGACAAGACCAGCTGCTGGCTGAGGGTCTCCTCGGCCTGGGCA
GGTGCGATGTACGGCGGCATCGCCATTCCGCGCATCGGCATGGAAGTGCTGGTGACTTTCCTTGAAGGCG
ACCCCGATCAGCCGCTGATCAGTGGCTGCCTGTACCACAAGGAAAACGTGGTTCCGTACGACCTGCCGGC
TAACAAAACCCGCAGCACTTTCAAGTCCATGAGTTCACCCGGTGGCGGCGGCTTCAACGAGCTGCGTATC
GAAGACAAGAAAGGCCAGGAACAGATATTCCTGCACGCCCAGCGCGACTGGGACGAGAACGTCGAGAACG
ATCAGAAGATACGCGTCGGCAACGAACGACACGACACAGTCGAGCAGAACAGCCACAGCGAATTCAAGGC
CGAAGAGCACCATACCGTCTACGCCGACCGCAAAGTCGAAGCACGGGCTGACGATCACCTCACCGTAGGT
GCGAACCAGCACGTCAAGGTCGGCACCGGTCAGTTCATCGAAGCAGGCCAAGAGATCCACCTGAGCAGCG
GCGTGAAAGTGGTGCTTGAAGCCGGTAGCGAATTGACCCTTAAGGCTGGGGGCAGCTTCATCAAGATCGA
CGCCAGCGGCGTGACCCTGAGCGGCCCGTTCATCCACGTCAACGACGGCGGTAGCCCCGGCAACGGCACC
CCGGCAGCCCCGCTGATGCCGGGTCCTTTGCTGCAGGCCGATGCCGACAAGGCCGGTGCGGCTCTAACCC
CGGCGCAGATCAACACCCTCAAACGCAACGCGCCGTTCTGTGAAGAATGCGAGAAGTGCAAGGACGGTGC
GTGTGCGATCTGA