SecReT6
Protein ID: 288935813
SecReT6 ID377
T6SS typei2
Gene symbol-
Locus tagKvar_2954
StrainKlebsiella variicola At-22
Repliconchromosome [GenBank: NC_013850] [Browse all T6SS(s) in this replicon]
Location [Strand]3074324..3074866 [-]
Producttype VI secretion lipoprotein
NoteTssJ
UniProt IDD3RI27, D3RI27
KEGG IDkva:Kvar_2954
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.60E-34, Aligned region: 17..171
Protein Sequence: 180 a.a.     [Download]
>gi|288935813|ref|YP_003439872.1| type VI secretion lipoprotein [Klebsiella variicola At-22]
MLRTSLTKTACLLPLLALCLSGCGLTQRVSEGTKNAFNAVFYKKINTLHLDFTAREALNTDARENHSLSE
PVVVRIYQLKDRQTFDRLVYQQLLEEGDILLAADLLASRDVVIGPGGDASLNMPLEAEATFVAVVGLFRY
PDTERNTWKQVLGREELDPDKPRIFTAERNQLRLRPEAAK
 
Nucleotide Sequence: 543 bp     [Download]
>ref|NC_013850.1|:c3074866-3074324 type VI secretion lipoprotein [Klebsiella variicola At-22]
GTGTTACGTACAAGTTTGACTAAAACCGCCTGCCTGCTGCCCCTGCTTGCGCTTTGTCTGAGCGGGTGCG
GGCTCACCCAGCGCGTCTCGGAGGGGACCAAAAATGCCTTCAACGCCGTTTTTTATAAGAAAATTAATAC
GCTGCATCTGGACTTTACCGCGCGTGAAGCGCTCAACACCGATGCCAGAGAGAATCACTCGCTCTCTGAA
CCGGTGGTGGTGCGCATCTATCAGCTTAAAGATCGCCAGACCTTTGACCGGCTGGTTTACCAGCAGCTGC
TGGAGGAGGGGGATATTCTGCTCGCCGCCGATCTCCTCGCCAGTCGCGATGTGGTGATCGGTCCCGGAGG
GGATGCCAGTCTGAATATGCCGCTGGAAGCGGAGGCGACGTTCGTGGCGGTTGTCGGCCTGTTCCGCTAT
CCGGACACAGAAAGAAATACCTGGAAGCAGGTGCTGGGGCGTGAGGAATTGGATCCGGACAAGCCGCGCA
TTTTCACCGCCGAACGCAACCAGCTACGGCTCAGGCCTGAAGCGGCGAAGTAA