SecReT6
Protein ID: 288935814
SecReT6 ID377
T6SS typei2
Gene symbol-
Locus tagKvar_2955
StrainKlebsiella variicola At-22
Repliconchromosome [GenBank: NC_013850] [Browse all T6SS(s) in this replicon]
Location [Strand]3074844..3075929 [-]
Producttype VI secretion protein
NoteTssG
UniProt IDD3RI28, D3RI28
KEGG IDkva:Kvar_2955
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 8.00E-73, Aligned region: 18..320
Protein Sequence: 361 a.a.     [Download]
>gi|288935814|ref|YP_003439873.1| type VI secretion protein [Klebsiella variicola At-22]
MGREAQPTHSRLNPRLEADLPRINFYRFCQLLEKRRPGQPLMGATSHPADDPVRFYPHPGMGFPASELRA
VEYDEADDCGPPVIRTTFMGLYGVDSPLPTAYLDDIAQRREGHEALQGLLDIFSHRIMTQFYRIWRKYSW
PATFEPGGTDRLSQSLLGLAGLGIPGTTQHIASPASRFLALTGVLRQPGKTQQGIQALVTLLAPETTVRV
SPYSLRPVAISQPLGFYGDDDFLLDGNMPLGDEAMDASSQLLVALTTDNPAEAQGSKPDGPLFRDFLILL
RVYLGWRFRADITLTAPTRLLAVPPLGDEPFWLGMNGMLGVGEGESQDDIPQTFTTELGTYTGLQPATFL
QGNRRVTYKFD
 
Nucleotide Sequence: 1086 bp     [Download]
>ref|NC_013850.1|:c3075929-3074844 type VI secretion protein [Klebsiella variicola At-22]
ATGGGAAGAGAAGCACAGCCGACGCATTCCCGGCTGAACCCGCGGCTGGAGGCCGACCTGCCGCGGATCA
ATTTTTACCGCTTCTGCCAGCTTCTGGAAAAACGGCGTCCTGGCCAACCGCTGATGGGGGCGACCAGCCA
TCCGGCTGACGATCCGGTGCGTTTTTACCCGCATCCGGGGATGGGATTCCCGGCCAGCGAACTCAGAGCC
GTGGAATACGATGAGGCCGATGACTGCGGGCCGCCGGTCATTCGCACCACCTTTATGGGGTTGTACGGTG
TCGATTCGCCGCTCCCGACGGCATATCTCGATGATATCGCCCAGCGCAGGGAAGGGCATGAAGCGCTGCA
GGGCTTACTGGATATCTTCAGCCACCGGATCATGACGCAGTTTTACCGCATCTGGCGGAAATACTCCTGG
CCCGCCACCTTTGAGCCTGGCGGCACCGATCGTCTCTCGCAGTCGCTGCTGGGCCTGGCGGGGTTGGGCA
TCCCCGGCACGACGCAGCATATCGCTTCGCCGGCGTCGCGCTTTCTGGCGCTAACTGGCGTGCTGCGGCA
GCCTGGCAAAACCCAGCAGGGGATCCAGGCGCTGGTCACCCTGCTGGCCCCGGAGACCACCGTCAGGGTG
AGCCCGTACAGCCTGCGTCCGGTGGCGATCAGTCAGCCGCTGGGGTTTTACGGCGATGACGACTTCTTAC
TGGACGGCAATATGCCGCTGGGTGACGAAGCGATGGATGCCAGCAGCCAGCTCCTCGTCGCCCTTACCAC
CGACAATCCCGCGGAGGCGCAGGGCTCGAAGCCTGACGGCCCGCTGTTTCGGGACTTTCTCATCCTGCTG
CGGGTATACCTCGGCTGGCGATTCCGGGCCGACATCACCCTGACCGCGCCGACCCGACTGCTGGCTGTCC
CGCCGCTGGGGGACGAGCCGTTCTGGCTCGGTATGAACGGCATGCTGGGTGTGGGGGAGGGCGAGAGTCA
GGACGATATTCCTCAGACCTTTACCACCGAGCTGGGTACCTATACGGGCCTGCAGCCTGCCACCTTTCTA
CAAGGAAACCGACGTGTTACGTACAAGTTTGACTAA