SecReT6
Protein ID: 288935815
SecReT6 ID377
T6SS typei2
Gene symbol-
Locus tagKvar_2956
StrainKlebsiella variicola At-22
Repliconchromosome [GenBank: NC_013850] [Browse all T6SS(s) in this replicon]
Location [Strand]3075893..3077647 [-]
Producttype VI secretion protein
NoteTssF
UniProt IDD3RI29, D3RI29
KEGG IDkva:Kvar_2956
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 6.10E-179, Aligned region: 6..581
Protein Sequence: 584 a.a.     [Download]
>gi|288935815|ref|YP_003439874.1| type VI secretion protein [Klebsiella variicola At-22]
MDDLTLRYYDAEMRYLLEAGEEFARAHPEQAAMLNLDKAGARDPFVERLFEGFAFLMGRMREKLDDDLPE
LTEGVVSLLWPHYLRTIPSMSVVEFTPDWPEMKEPMTMVKGFEVLSRPIGEKGTRCRYTTTKAIALQPLF
LELARLATDTDGRSVITLRFTCSQLTDWSRVDLSHIPLYCNADAPLACAMHEAFTLNVARMWLRMPDEVD
RKPLDGYFSALGFGEEDSLWPEDGRSFRGYQLLLEYFTFREKFMFIDLRGLETVAFPAGLAWFEIDVVLA
ERWEHDFRFSEKQLRLHCVPVINLFPLESDPLTINSLQTEYPLRPMRVQDGHTKIYTVDSVISSHQQVYA
PFSSFRHKGGMMRHDAADYYYHTRVRRGPSGLYNTWLIVGGEAFDNHTVPEDESLSLTLTGTNGQLPRRA
LQSTVLDTVMKTTSASVAVRNLCAPTLPCYPPAQDRFHWRVLSHLGSSFLSLMDNAEVLRGTLALYEWTD
SEMNRRRLEAILDVNHRATERFAQGHLVRGVQIEVTLDSHGFAGRGDICLFGEMLSRFFALYTDIYLFNR
LIIILQPTGERLEWEEKHSRRIPG
 
Nucleotide Sequence: 1755 bp     [Download]
>ref|NC_013850.1|:c3077647-3075893 type VI secretion protein [Klebsiella variicola At-22]
ATGGACGATTTAACCCTGCGTTATTACGACGCTGAAATGCGCTACCTGCTGGAAGCGGGTGAAGAGTTTG
CCCGCGCTCATCCTGAGCAGGCGGCAATGCTCAATCTCGACAAAGCGGGCGCCCGCGACCCCTTTGTTGA
GCGCCTGTTTGAAGGTTTTGCCTTCCTGATGGGCCGCATGCGCGAGAAGCTCGATGACGATCTGCCTGAG
CTGACCGAAGGCGTGGTCAGTCTGCTGTGGCCCCATTATTTACGTACCATTCCCTCGATGTCGGTCGTGG
AATTCACCCCCGACTGGCCGGAAATGAAAGAGCCGATGACGATGGTCAAAGGCTTTGAAGTGCTTTCCCG
GCCGATCGGTGAAAAGGGCACGCGCTGCCGGTACACCACCACCAAAGCGATCGCTCTACAGCCGTTATTC
CTTGAGCTAGCCCGGCTGGCCACCGATACGGATGGCCGGTCGGTGATCACGTTGCGCTTTACCTGCAGCC
AACTGACGGACTGGAGCCGGGTCGATCTCAGTCATATCCCGCTCTACTGTAACGCCGATGCGCCGCTGGC
CTGCGCCATGCACGAGGCCTTTACCCTCAATGTGGCCCGGATGTGGCTGCGTATGCCTGATGAGGTAGAC
AGAAAGCCGCTGGACGGGTATTTCAGCGCGCTGGGATTTGGCGAGGAGGACAGCCTCTGGCCTGAAGATG
GCCGCAGTTTTCGCGGTTACCAGCTGCTGCTGGAGTATTTTACCTTCCGCGAAAAGTTCATGTTCATCGA
TCTGCGCGGGCTGGAGACGGTGGCTTTTCCGGCCGGACTGGCGTGGTTTGAAATCGACGTCGTGCTGGCG
GAACGCTGGGAACATGACTTCCGCTTCAGCGAAAAGCAGCTGCGCCTGCACTGCGTGCCAGTGATCAACC
TGTTTCCGCTGGAGTCCGATCCGCTGACCATCAATTCCCTGCAGACCGAATACCCGCTGCGCCCGATGCG
CGTGCAGGACGGCCACACCAAAATTTACACCGTCGATTCCGTGATCTCCTCGCACCAGCAGGTTTACGCG
CCGTTCTCAAGTTTTCGCCACAAAGGCGGCATGATGCGTCATGACGCGGCGGACTATTACTATCATACCC
GGGTGCGCCGTGGCCCCTCCGGGCTGTACAACACCTGGCTTATCGTCGGCGGGGAAGCCTTTGACAATCA
TACCGTACCGGAAGATGAAAGCCTGTCGCTGACCCTCACCGGAACTAACGGCCAACTGCCGCGTCGCGCG
CTGCAGAGCACCGTACTCGATACGGTGATGAAAACCACTTCCGCCAGCGTCGCGGTGCGTAACCTCTGCG
CACCAACGCTGCCGTGCTATCCCCCGGCCCAGGACCGCTTTCACTGGCGGGTGCTGAGCCATCTGGGCAG
CAGTTTTCTTTCCCTGATGGACAACGCTGAAGTCCTGCGCGGCACCCTGGCGCTGTATGAATGGACCGAC
AGCGAGATGAATCGTCGGCGTCTGGAAGCCATCCTCGACGTGAATCACCGCGCGACAGAGCGCTTTGCTC
AGGGCCATCTGGTGCGCGGCGTGCAGATTGAAGTCACCCTCGACAGTCACGGCTTTGCCGGACGAGGCGA
CATATGCCTGTTTGGCGAGATGCTTAGCCGCTTCTTCGCGCTCTACACCGACATCTATTTGTTCAACCGC
CTGATTATCATTCTGCAACCAACCGGAGAACGACTGGAATGGGAAGAGAAGCACAGCCGACGCATTCCCG
GCTGA