SecReT6
Protein ID: 288935816
SecReT6 ID377
T6SS typei2
Gene symbol-
Locus tagKvar_2957
StrainKlebsiella variicola At-22
Repliconchromosome [GenBank: NC_013850] [Browse all T6SS(s) in this replicon]
Location [Strand]3077727..3079319 [-]
Producttype VI secretion-associated protein
NoteTssA
UniProt IDD3RI30
KEGG IDkva:Kvar_2957
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.30E-20, Aligned region: 66..126
ImpA-rel_N [PF06812], Evalue: 1.30E-20, Aligned region: 166..177
Protein Sequence: 530 a.a.     [Download]
>gi|288935816|ref|YP_003439875.1| type VI secretion-associated protein [Klebsiella variicola At-22]
MSILQNLVAASQLDESVLRQQARSRQAQWQSWLSPISDSQPTGSDPGYDDDFQRIREEVNKISGVDTELI
CQLAEKLLTQTCKDLRVITFYVWARLQREGESGLAEGVTLLAAMLERFGAMLHPQRERSCKSALEWLGSR
RMSDSLSLYPEVDMTTMQVIIGALLLAEASFAGLAEASRPDLSGLYQILENRLVQNGGARSLVPQTSREE
HDLLPQHADTAPVMHTVTSGRDLLDQAKVLAKYLRECPGGWLAGHHLMKSVRWDTLTELPPLDASGRTRL
LPPKPESKAHLKRLYLQKSWSELLEHTDTLLAQGVNHLWLDVQWYAWQALLKLDADSVRADILCRDMKGL
LARLPGLETLAFNDGTPFADEVTLNWLNERVLDEMAGWQDEPVMAATSADEVLSLEPEVLTRADDEGIES
ALNWLQAQPGYTTSRNRWLMRLLMARVSEQYGKNEMALHLLAELDSRAREMTLEQWKPELIFEVKARRLR
LLRGKAGRSEAEKNRLLPEMESLLAGLIALDPARAAVLCA
 
Nucleotide Sequence: 1593 bp     [Download]
>ref|NC_013850.1|:c3079319-3077727 type VI secretion-associated protein [Klebsiella variicola At-22]
ATGAGCATTTTACAAAATTTGGTTGCCGCCAGTCAGTTGGATGAAAGCGTACTGCGCCAGCAGGCCCGGT
CACGTCAGGCGCAGTGGCAGTCCTGGCTTTCGCCAATCAGTGATAGCCAGCCCACCGGGAGCGATCCGGG
CTATGACGATGATTTTCAGCGTATCCGCGAGGAGGTCAATAAGATCTCCGGTGTCGATACCGAGCTGATT
TGCCAGCTGGCAGAAAAACTGCTGACTCAGACCTGCAAGGATCTGCGCGTGATCACCTTTTACGTGTGGG
CGCGTCTGCAGCGGGAAGGCGAGAGCGGTCTGGCGGAAGGCGTTACGCTGCTGGCGGCAATGCTTGAGCG
GTTTGGGGCTATGCTCCATCCCCAGCGTGAACGTAGCTGTAAATCGGCGCTGGAATGGCTTGGCAGTCGC
CGGATGTCGGACAGTCTGTCTCTTTATCCGGAAGTCGACATGACCACTATGCAGGTCATTATCGGGGCGT
TATTGCTGGCGGAAGCCTCTTTTGCCGGCTTGGCTGAGGCATCCCGCCCCGATCTTTCCGGGCTATACCA
GATACTGGAGAACCGCCTGGTGCAAAACGGCGGAGCCCGCAGTCTGGTGCCGCAGACCAGCCGCGAAGAA
CACGATCTGCTACCCCAACATGCGGACACCGCGCCGGTAATGCATACCGTCACGTCAGGTCGTGATTTGC
TCGATCAGGCTAAGGTGCTGGCGAAATATCTGCGCGAGTGTCCCGGCGGATGGCTGGCAGGTCATCATCT
GATGAAGAGTGTGCGTTGGGATACCTTAACGGAGTTACCGCCGCTGGATGCCTCCGGCCGGACACGGCTA
TTGCCTCCCAAGCCTGAGAGTAAAGCCCATCTTAAGCGGTTGTATTTACAGAAAAGCTGGTCGGAACTGC
TGGAGCATACGGACACGCTGTTGGCGCAAGGCGTCAACCATCTGTGGCTGGATGTGCAGTGGTACGCCTG
GCAGGCGCTGCTGAAACTGGATGCTGACAGTGTACGTGCCGATATCCTGTGCCGGGATATGAAAGGGCTA
CTGGCTCGTCTGCCGGGGCTGGAAACCCTGGCGTTTAACGATGGTACGCCATTCGCCGATGAAGTAACGC
TCAACTGGCTTAACGAGCGTGTTCTGGATGAGATGGCCGGATGGCAAGATGAACCGGTAATGGCGGCGAC
CAGCGCTGATGAGGTGCTGTCGCTGGAGCCAGAAGTGCTCACCCGCGCGGACGATGAAGGTATTGAGTCG
GCGCTGAACTGGTTACAGGCGCAGCCGGGCTATACCACCAGCCGCAATCGGTGGCTGATGCGCTTATTGA
TGGCGCGGGTCAGCGAGCAGTACGGAAAAAATGAAATGGCGCTGCATCTGCTGGCGGAACTCGACAGCCG
CGCCCGGGAAATGACGCTCGAACAATGGAAGCCGGAGCTTATCTTTGAGGTCAAAGCCCGCCGACTCCGG
CTGCTCAGAGGCAAGGCCGGGCGCAGTGAGGCAGAAAAAAATCGCTTGCTGCCAGAAATGGAGTCATTGC
TTGCCGGGCTTATCGCTCTGGATCCCGCTCGCGCTGCGGTGCTGTGCGCATAA