SecReT6
Protein ID: 288935827
SecReT6 ID377
T6SS typei2
Gene symbol-
Locus tagKvar_2968
StrainKlebsiella variicola At-22
Repliconchromosome [GenBank: NC_013850] [Browse all T6SS(s) in this replicon]
Location [Strand]3090311..3092689 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDD3RI41, D3RI41
KEGG IDkva:Kvar_2968
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.30E-66, Aligned region: 34..355
DUF2345 [PF10106], Evalue: 2.50E-42, Aligned region: 551..563
DUF2345 [PF10106], Evalue: 2.50E-42, Aligned region: 613..759
T6SS_Vgr [PF13296], Evalue: 9.80E-34, Aligned region: 489..591
T6SS_Vgr [PF13296], Evalue: 9.80E-34, Aligned region: 628..677
Phage_base_V [PF04717], Evalue: 1.10E-16, Aligned region: 339..358
Phage_base_V [PF04717], Evalue: 1.10E-16, Aligned region: 389..482
Protein Sequence: 792 a.a.     [Download]
>gi|288935827|ref|YP_003439886.1| Rhs element Vgr protein [Klebsiella variicola At-22]
MSSVKSLLFSHNHHLLSVKGCEAGLDVLAFEGDEALSQPFRYRIEFTSADHAISKEMMLMKAASLTLQAP
VAQGFGINVQQPVRVIQGVVTGFERLSTSRDETHYALTLQPRLALLNRSHQNAIYQDQSVPQIVEKILRE
RHGLRGQDFLFSLTKTYPRREQVMQYGEDDLRFITRLLGEVGIWFRFTADTRLHIDVAEFCDSQQGYEKG
LTLPSVPPSGQQSAGVDAVWEMACRHRVVEQQVSTRDYNYREATADMNAQVDVTRGETTTFGEAYHWGDN
YLTAGNVHDRHPAPESGAFYARLRHERYLNGQTRMQATTSCPTLCPGQVLKVTGGEEVAGEFADGVLVTA
MHSHARRDADFAVEFAGIPDSPDVGYRPEPGARPVMAGTLPARVTSTRENDTYGHIDKHGRYRVNMLFDR
ARWETGFESLWVRQSRPYAGDTYGLHLPLLAGTEVAIGFEDGNPDRPYIAGVLHDSAHGDHVTIRNDKRN
VLRTPANNKIRLDDERGKEHIKVSTEYGGKSQLNLGHLVDAEKQQRGDGFELRTDSWGAIRAQKGIFISA
DGQAQAQGQVLAMEPAVSLLKGAVNQVTEWGSITQTHHNVIPDTGPLSALTTGASDLKQPTLLMSAPQGI
AAVTPETTLLHSGNGLYLQSLGEVNITTAQRCSLNASQAISLLAQQEGMRLVSAKGPLEVESHSDILSLT
ALKDITVQSTQGHLQLTAKNGITLGCGGAYIRLTPQGEVQIHGPGVISLKGQHDLQGPVSEAFPLPELPA
SVCKECLKKAQALAQGFVPREA
 
Nucleotide Sequence: 2379 bp     [Download]
>ref|NC_013850.1|:c3092689-3090311 Rhs element Vgr protein [Klebsiella variicola At-22]
ATGAGTAGCGTGAAATCGTTGTTGTTCAGCCATAACCACCACCTGCTTTCGGTGAAGGGATGTGAAGCCG
GGCTTGATGTGCTGGCCTTCGAGGGCGATGAAGCCCTGAGCCAGCCGTTCCGCTACCGTATTGAATTCAC
CAGCGCAGACCATGCCATCAGCAAAGAGATGATGCTGATGAAGGCAGCCTCCCTGACGCTGCAGGCGCCG
GTGGCTCAGGGCTTCGGCATCAATGTTCAGCAACCCGTGCGGGTTATCCAGGGCGTGGTGACGGGGTTTG
AACGGCTCAGTACCTCCAGGGATGAAACGCACTACGCGCTGACGCTTCAGCCACGCCTGGCGCTGCTTAA
CCGCTCGCACCAGAACGCCATTTACCAGGACCAGTCCGTTCCGCAGATTGTGGAAAAAATCCTCCGCGAG
CGCCACGGCCTGCGCGGTCAGGATTTTCTGTTCTCGCTGACAAAAACGTATCCGCGCCGCGAGCAAGTGA
TGCAGTACGGCGAGGATGACCTGCGCTTTATCACCCGGCTGCTGGGTGAGGTGGGGATCTGGTTTCGCTT
TACCGCCGACACGCGGCTGCACATCGACGTCGCTGAGTTCTGCGACAGTCAGCAGGGCTATGAGAAGGGG
CTGACGTTGCCTTCGGTCCCGCCGTCAGGGCAGCAGTCGGCCGGGGTGGACGCGGTGTGGGAGATGGCAT
GCCGCCACCGCGTCGTGGAGCAGCAGGTCAGTACCCGCGACTACAACTACCGCGAGGCGACGGCGGACAT
GAACGCGCAGGTGGATGTCACCCGCGGGGAGACCACCACCTTTGGTGAGGCTTACCACTGGGGAGATAAC
TACCTGACCGCCGGGAATGTCCATGACCGCCATCCGGCGCCGGAGTCCGGGGCGTTTTACGCCCGGCTTC
GCCATGAGCGTTATCTTAACGGCCAGACCCGGATGCAGGCCACCACCAGCTGCCCGACGCTCTGCCCGGG
ACAGGTGTTGAAGGTCACCGGCGGAGAGGAAGTGGCCGGGGAGTTTGCTGATGGCGTGCTCGTCACGGCG
ATGCACAGCCACGCCCGGCGCGATGCCGACTTTGCGGTGGAGTTTGCCGGCATACCGGACAGCCCGGACG
TCGGCTACCGGCCTGAGCCCGGCGCGCGTCCGGTGATGGCCGGGACGCTGCCGGCCCGCGTGACCAGCAC
CCGGGAAAACGACACCTACGGGCATATCGACAAACACGGGCGCTACCGGGTGAATATGCTGTTTGACCGG
GCGCGCTGGGAAACCGGGTTCGAGAGCCTGTGGGTCCGCCAGTCGCGGCCGTATGCCGGAGACACCTACG
GTCTGCACCTGCCGCTGCTGGCGGGGACGGAGGTGGCGATTGGCTTTGAGGATGGTAACCCCGACCGGCC
GTATATCGCGGGCGTGCTGCACGACTCGGCGCACGGCGACCATGTCACCATCCGCAATGACAAACGTAAC
GTCCTGCGCACCCCGGCCAACAACAAAATCCGCCTCGACGATGAGCGCGGGAAAGAACATATCAAGGTGT
CGACGGAGTATGGCGGCAAGAGCCAGCTGAACCTCGGCCATCTCGTGGATGCTGAAAAGCAGCAGCGCGG
GGACGGTTTTGAGCTAAGAACCGACAGCTGGGGAGCTATCCGGGCACAGAAAGGGATATTTATCAGCGCT
GACGGGCAGGCGCAGGCTCAGGGGCAGGTGCTGGCGATGGAGCCGGCGGTCAGTTTGCTGAAAGGTGCGG
TGAATCAGGTCACGGAATGGGGAAGCATTACGCAAACCCATCATAATGTTATCCCAGACACCGGCCCATT
AAGCGCACTGACCACAGGCGCCAGCGATCTTAAACAGCCGACATTGCTGATGTCGGCCCCGCAGGGGATT
GCCGCAGTCACGCCGGAAACAACACTCCTGCACAGCGGTAACGGGCTGTATCTGCAGAGCCTGGGGGAGG
TCAACATCACCACGGCACAGCGCTGTTCTCTGAATGCCAGCCAGGCTATTTCACTGCTGGCGCAACAGGA
GGGGATGAGGCTGGTCTCCGCCAAAGGTCCGCTGGAAGTAGAGTCGCACAGCGATATTCTGTCGCTGACC
GCGCTAAAAGATATCACCGTCCAGTCAACCCAGGGGCATCTGCAGTTGACGGCTAAAAATGGCATCACCC
TGGGTTGCGGCGGCGCATATATCCGTCTTACCCCGCAGGGAGAGGTACAGATCCACGGACCGGGGGTGAT
TAGCCTTAAGGGGCAGCATGATTTGCAGGGGCCGGTCAGCGAGGCGTTTCCCTTGCCTGAGCTACCGGCA
TCGGTGTGTAAAGAGTGCCTTAAAAAAGCCCAGGCGCTGGCGCAGGGCTTCGTGCCGCGGGAGGCATAG