SecReT6
Protein ID: 288935832
SecReT6 ID377
T6SS typei2
Gene symbol-
Locus tagKvar_2973
StrainKlebsiella variicola At-22
Repliconchromosome [GenBank: NC_013850] [Browse all T6SS(s) in this replicon]
Location [Strand]3098486..3099829 [-]
Producttype VI secretion protein
NoteTssK
UniProt IDD3RI46, D3RI46
KEGG IDkva:Kvar_2973
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.30E-136, Aligned region: 19..444
Protein Sequence: 447 a.a.     [Download]
>gi|288935832|ref|YP_003439891.1| type VI secretion protein [Klebsiella variicola At-22]
MMKTERPLWGRGIMVSPQHFQQQAAYAAWTAEVIARMGLNHPWGVMEATFEPEMLKLGRLQAHRLQVRFQ
DGTMIDTDNADALPSALSLDGASGEAVIVLALPLMQANGGNCLKPEEVAERPVRFRQRWRDVRNQFGDDT
RQIAVMQPELTLRFAHQDNSDYLTCPLVRLQRDSQGAWLIDETFLPPLLQIQGSRWLATQLEQLLTQLRA
RLTRLMAMRRESNERMADFAVADVSLFWLLNALNSAEPVLGYFLRDQQSPPERLYPELARLAGSLLTFSL
THQANVVPIYQHDQLNAVFPPLFDLLSDLLEASLPSRVVAIALEHDARLHFWQARLHDARLREGADYYLS
VRSSVPVARLQEQFPRQCKVGSPDHVKAIVNSSRTGVPLTPLRHVPAAIPLRLENQYFSLDVSHPLATEM
LQSGTCMFYVPGMLGEPELELFAVLRT
 
Nucleotide Sequence: 1344 bp     [Download]
>ref|NC_013850.1|:c3099829-3098486 type VI secretion protein [Klebsiella variicola At-22]
ATGATGAAAACGGAACGTCCGTTGTGGGGCCGGGGCATTATGGTGTCGCCCCAGCATTTTCAACAGCAGG
CTGCGTATGCAGCCTGGACTGCGGAAGTGATTGCCCGGATGGGGCTTAACCACCCCTGGGGAGTGATGGA
GGCGACCTTCGAACCAGAGATGCTCAAACTGGGCCGCCTGCAGGCTCACAGGCTGCAGGTCCGGTTCCAG
GATGGCACGATGATTGATACGGACAATGCTGATGCGCTGCCGTCCGCGCTGTCACTGGACGGCGCGTCCG
GCGAGGCGGTGATCGTGCTGGCGCTGCCCCTGATGCAGGCGAATGGCGGCAACTGTCTGAAGCCGGAGGA
GGTGGCCGAAAGGCCGGTGCGCTTCCGGCAGCGCTGGCGTGATGTCCGCAACCAGTTCGGGGATGATACC
CGGCAGATTGCCGTCATGCAGCCGGAGCTGACCCTCCGTTTCGCCCATCAGGACAACAGCGATTACCTGA
CCTGTCCGCTTGTTCGCCTGCAGCGGGACTCGCAGGGGGCCTGGCTTATCGACGAGACGTTTCTCCCGCC
GCTGCTGCAGATCCAGGGCAGCCGCTGGCTGGCGACGCAGCTTGAACAGCTGCTTACTCAGCTTCGGGCT
CGTCTGACGCGCCTGATGGCCATGCGTCGCGAGAGCAATGAACGGATGGCTGATTTTGCCGTGGCCGATG
TCTCTCTGTTCTGGTTGCTGAACGCGCTGAACAGCGCCGAGCCGGTGCTGGGGTACTTTCTGCGTGACCA
ACAGAGCCCGCCGGAACGCCTCTATCCGGAGCTGGCGCGCCTGGCTGGCAGCCTGCTGACCTTTTCGCTT
ACCCATCAGGCGAATGTCGTCCCGATCTATCAACATGACCAGCTGAACGCGGTTTTTCCGCCGCTGTTTG
ATTTACTGAGCGACCTGCTGGAGGCGAGCCTGCCGTCTCGGGTGGTGGCGATTGCGCTGGAGCATGATGC
CCGGCTGCACTTCTGGCAGGCGCGTCTGCACGATGCCCGGCTGCGGGAAGGGGCTGATTACTATCTGTCG
GTTCGTTCGTCGGTACCGGTCGCCCGGCTGCAGGAGCAGTTTCCGCGACAGTGCAAAGTGGGCAGTCCGG
ATCATGTCAAAGCCATCGTCAACTCCTCGCGGACAGGGGTGCCCCTCACGCCATTGCGTCATGTGCCGGC
GGCGATCCCGCTGCGTCTGGAAAATCAGTATTTCAGCCTCGATGTGTCCCACCCTCTGGCGACGGAAATG
CTGCAGAGCGGCACCTGTATGTTTTACGTCCCGGGGATGCTCGGTGAGCCTGAACTTGAACTTTTTGCGG
TACTACGAACGTGA