SecReT6
Protein ID: 288935833
SecReT6 ID377
T6SS typei2
Gene symbol-
Locus tagKvar_2974
StrainKlebsiella variicola At-22
Repliconchromosome [GenBank: NC_013850] [Browse all T6SS(s) in this replicon]
Location [Strand]3099839..3101383 [-]
ProductEvpB family type VI secretion protein
NoteTssC
UniProt IDD3RI47, D3RI47
KEGG IDkva:Kvar_2974
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.40E-171, Aligned region: 88..510
Protein Sequence: 514 a.a.     [Download]
>gi|288935833|ref|YP_003439892.1| EvpB family type VI secretion protein [Klebsiella variicola At-22]
MSVTTENAPVQGQTTLQENRAGEGVYASLFEKINLAPASHLGDINDFLDDAALSEAPAAERLTAAMQVFM
ERIRQSGQRVEKLDKTLIDHHIAELDFQISRQLDAVMHHQEFQQVESLWRGLKQLVDNTDYRQNVKTEIL
DVAKDDLRQDFEDAPELIQSGLYWHTYTAEYDTPGGEPIGSVISAYEFDASPQDVALLRNISRVSAAAHM
PFIGAVGPAFFLKETMEEVAAIKDIGNYFDRAEYIRWKSFRETDDARYIGLVMPRVLGRLPYGPDTVPVR
SFNYVEQVKGPEHEKYLWTSAAFSFASNMVKSFVNNGWCVQIRGPQAGGAVKDLPIHLYDLGTGNQVKIP
SEVMIPETREFEFASLGFIPLSYYKNRDYACFFSANSAQKPALYDTADATANSRINARLPYIFLLSRIAH
YLKMIQRENIGTTKDRRLLELELNTWVRSLVTEMTDPGDELQASHPLRDASVVVEDIEDNPGFFRVKLYA
VPHFQVEGMDVNLSLVSQMPKAKA
 
Nucleotide Sequence: 1545 bp     [Download]
>ref|NC_013850.1|:c3101383-3099839 EvpB family type VI secretion protein [Klebsiella variicola At-22]
ATGTCTGTTACCACAGAAAACGCCCCTGTTCAGGGGCAAACCACGTTGCAGGAAAATAGGGCGGGCGAGG
GCGTTTACGCCTCGCTGTTTGAAAAAATTAATCTCGCCCCGGCCTCTCACCTCGGGGATATCAACGACTT
TCTGGACGATGCCGCGCTCTCCGAGGCGCCGGCGGCGGAACGTCTCACCGCGGCGATGCAGGTGTTTATG
GAGCGCATCCGTCAGTCCGGTCAGCGGGTGGAAAAGCTCGACAAAACGCTGATTGATCACCATATCGCCG
AACTGGATTTCCAGATAAGCCGTCAGCTGGACGCGGTGATGCACCATCAGGAGTTTCAGCAGGTCGAATC
CCTGTGGCGCGGCCTCAAACAGCTGGTGGACAACACCGACTATCGGCAGAACGTCAAAACGGAGATCCTG
GACGTCGCCAAAGACGATCTGCGCCAGGACTTTGAGGACGCGCCGGAGCTTATCCAGAGCGGCCTCTACT
GGCACACCTATACCGCGGAGTATGACACTCCCGGCGGCGAGCCGATCGGCTCGGTGATCTCGGCCTATGA
GTTCGACGCCAGCCCGCAGGATGTGGCGCTCCTGCGCAATATCTCCCGCGTCTCTGCGGCCGCCCATATG
CCGTTTATCGGCGCCGTCGGCCCGGCCTTCTTCCTGAAAGAGACCATGGAAGAGGTGGCTGCTATTAAGG
ATATCGGCAACTACTTCGATCGCGCGGAATATATCCGCTGGAAATCATTTCGTGAAACCGACGATGCCCG
CTACATCGGTCTGGTGATGCCGCGCGTGCTGGGTCGTCTGCCGTACGGTCCGGACACCGTGCCGGTGCGC
AGCTTCAACTATGTCGAGCAGGTGAAAGGTCCGGAGCACGAAAAGTATCTGTGGACCAGCGCAGCGTTCT
CCTTCGCTTCCAATATGGTGAAGAGCTTTGTCAATAACGGCTGGTGCGTGCAGATCCGCGGTCCGCAGGC
CGGCGGCGCGGTGAAAGATCTGCCCATCCACCTGTACGATCTGGGCACCGGCAACCAGGTGAAGATCCCT
TCCGAGGTGATGATCCCGGAAACGCGGGAGTTTGAGTTCGCCAGCCTGGGCTTTATCCCGCTGTCGTACT
ACAAAAATCGCGATTACGCCTGCTTCTTCTCGGCCAACTCCGCGCAGAAACCGGCGCTGTACGATACCGC
CGACGCCACCGCCAACAGCCGCATCAACGCGCGTCTGCCTTATATCTTCCTGCTGTCGCGCATCGCGCAC
TACCTGAAGATGATCCAGCGCGAGAATATCGGCACCACCAAGGACCGGCGGCTGCTGGAGCTGGAGCTGA
ACACCTGGGTGCGGAGCCTGGTGACTGAAATGACCGACCCCGGCGACGAGCTGCAGGCCTCCCATCCGCT
GCGCGATGCCAGTGTGGTGGTGGAAGATATTGAGGATAACCCGGGCTTCTTCCGCGTGAAGCTGTACGCG
GTGCCGCACTTCCAGGTCGAGGGGATGGACGTCAATCTGTCGCTGGTTAGCCAGATGCCGAAGGCGAAGG
CGTAG