SecReT6
Protein ID: 288935834
SecReT6 ID377
T6SS typei2
Gene symbol-
Locus tagKvar_2975
StrainKlebsiella variicola At-22
Repliconchromosome [GenBank: NC_013850] [Browse all T6SS(s) in this replicon]
Location [Strand]3101426..3101917 [-]
Producttype VI secretion protein
NoteTssB
UniProt IDD3RI48, D3RI48
KEGG IDkva:Kvar_2975
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.20E-53, Aligned region: 6..158
Protein Sequence: 163 a.a.     [Download]
>gi|288935834|ref|YP_003439893.1| type VI secretion protein [Klebsiella variicola At-22]
MADTFQNEVPRARINLKLSLHTGGAQKKVELPLKLLTIGDFSHGKENRPLSEREKINVNKNNFNSVLSEF
SPEVNLSVPNTLSGNGEEENVRLRFTDIKDFEPEQVARQIPQLRAMLAMRNLLRDLKSNLLDNATFRKEL
EAILKDPALSQELRDEMSALAPK
 
Nucleotide Sequence: 492 bp     [Download]
>ref|NC_013850.1|:c3101917-3101426 type VI secretion protein [Klebsiella variicola At-22]
ATGGCTGATACGTTCCAGAATGAAGTCCCCAGGGCGCGCATTAATCTCAAATTATCTCTTCATACCGGCG
GCGCGCAGAAGAAGGTCGAGCTACCGCTGAAGCTGCTTACCATTGGCGATTTTAGTCATGGTAAGGAAAA
CCGGCCTTTATCGGAAAGAGAAAAAATCAACGTCAATAAAAATAACTTTAACAGCGTACTTTCGGAATTT
AGCCCGGAAGTTAACCTCTCGGTGCCGAATACGCTGTCCGGCAATGGTGAAGAGGAGAACGTCAGACTGC
GTTTTACCGATATCAAAGATTTTGAACCGGAGCAGGTTGCCCGGCAAATTCCGCAACTCCGCGCCATGCT
GGCGATGCGTAATTTATTACGCGATCTCAAATCCAATCTGCTTGATAACGCCACTTTCAGAAAAGAGCTT
GAGGCAATCCTGAAAGATCCGGCGCTGTCCCAGGAATTACGCGACGAAATGAGTGCGCTTGCCCCGAAAT
AA