SecReT6
Protein ID: 288959892
SecReT6 ID379
T6SS typei4a
Gene symbol-
Locus tagAZL_a01570
StrainAzospirillum sp. B510
Repliconplasmid pAB510a [GenBank: NC_013855] [Browse all T6SS(s) in this replicon]
Location [Strand]178844..179437 [-]
Producthypothetical protein
NoteTssD
UniProt IDD3NZ59
KEGG IDazl:AZL_a01570
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.30E-11, Aligned region: 5..33
DUF796 [PF05638], Evalue: 3.30E-11, Aligned region: 73..176
Protein Sequence: 197 a.a.     [Download]
>gi|288959892|ref|YP_003450232.1| hypothetical protein AZL_a01570 [Azospirillum sp. B510]
MRILLKYPGIAGDSLLQGYSNLIFCTKFDMRTGTNDAGSLEYGAAVEDNDYDVYGIAAMQENYRKVKPRS
KPRTVGIDSVDLGKPIDMASPLLLKTAFADPVPGAEATIYFLRPIDTQASAEQSGLAGGTIGFDKFLTIV
LTDVHVTSYTVSAGTSADNSGDETISLSFTKLNMTYVHYKNGQPQNVPVEIKVAKKK
 
Nucleotide Sequence: 594 bp     [Download]
>gi|288959735|ref|NC_013855.1|:c179437-178844 Azospirillum sp. B510 plasmid pAB510a, complete sequence
ATGCGCATTCTTCTCAAATATCCGGGCATTGCCGGCGATTCGCTGCTCCAGGGCTACAGCAACCTGATCT
TCTGCACCAAGTTCGACATGAGAACCGGAACGAACGACGCCGGCTCTCTGGAATACGGCGCGGCGGTCGA
GGACAACGACTACGACGTCTATGGCATTGCAGCGATGCAGGAAAATTATCGCAAGGTGAAGCCGCGGTCG
AAGCCGCGCACGGTCGGGATCGACAGCGTCGACCTCGGCAAGCCCATCGACATGGCCTCGCCGCTGTTGC
TGAAGACGGCGTTCGCCGATCCCGTGCCGGGCGCCGAGGCCACGATCTACTTCCTGCGGCCGATAGACAC
GCAAGCATCGGCCGAGCAGTCGGGCCTCGCCGGCGGCACGATCGGCTTCGACAAGTTCCTGACCATCGTT
CTGACAGACGTCCATGTCACGTCCTACACGGTCAGCGCCGGCACCAGCGCCGATAACAGTGGCGACGAGA
CGATCTCGCTGTCCTTCACCAAACTCAACATGACTTACGTCCATTACAAGAACGGCCAACCGCAGAACGT
TCCGGTTGAAATCAAGGTGGCAAAGAAAAAATGA