SecReT6
Protein ID: 288959893
SecReT6 ID379
T6SS typei4a
Gene symbol-
Locus tagAZL_a01580
StrainAzospirillum sp. B510
Repliconplasmid pAB510a [GenBank: NC_013855] [Browse all T6SS(s) in this replicon]
Location [Strand]179445..180575 [-]
ProductimpA domain protein
NoteTssA
UniProt IDD3NZ60
KEGG IDazl:AZL_a01580
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.80E-20, Aligned region: 64..123
Protein Sequence: 376 a.a.     [Download]
>gi|288959893|ref|YP_003450233.1| impA domain protein [Azospirillum sp. B510]
MTDARTAERPLIDTERILAPIPGDLPAGEDIRYEPEFDALAEARRMDDDTDKGIWQTDDVKRADWKGVVV
GATELLASRSKDLQVAVWLVQALVQQHGPAAIAPGLSMLTGLVDAFWDGLYPRIDEDGDTEARLAPLLWL
DERLSRDLLALPIALPEPGAKSGLRLQDWQNAQRLRKLAGRDARAYKAAIAEGEVPVERIVKDVEKTPSD
FYVAQRDSLKAAEAAAHALGAALDRLAGRNAPALSRIKRTVEELCRFQEDVLRKRGVTLEPTASVAAPEA
ASEAAGTGDAATTPGAAAHPAGAAWTGGPRNREEAYGMLRQIADYLEQEEPHSPTSYLVRRAASWGQLSL
PELYADLLGDRGEVGRMFSVLRLKDE
 
Nucleotide Sequence: 1131 bp     [Download]
>gi|288959735|ref|NC_013855.1|:c180575-179445 Azospirillum sp. B510 plasmid pAB510a, complete sequence
ATGACCGACGCGCGGACTGCTGAACGCCCACTCATCGACACCGAACGGATTCTCGCGCCGATTCCGGGAG
ATCTTCCGGCCGGCGAGGACATCCGCTACGAGCCGGAATTCGACGCGCTGGCGGAGGCGCGGCGCATGGA
TGACGACACGGACAAGGGGATCTGGCAGACCGACGACGTCAAGCGGGCCGACTGGAAGGGTGTCGTGGTC
GGCGCAACCGAACTGCTGGCTAGCCGTTCGAAGGATCTCCAGGTTGCCGTTTGGCTGGTCCAGGCGCTGG
TGCAGCAGCACGGACCCGCCGCCATCGCGCCGGGCCTGTCCATGCTCACCGGCCTTGTCGATGCCTTTTG
GGACGGCCTCTACCCACGCATCGACGAGGACGGGGACACCGAGGCGCGCTTGGCGCCCCTGCTTTGGCTG
GACGAGCGCTTGTCCCGCGACCTCCTGGCGCTGCCCATCGCTCTGCCGGAACCGGGCGCCAAGTCGGGGC
TCCGGCTCCAGGACTGGCAGAACGCCCAGCGCCTGCGCAAGCTGGCGGGCCGTGATGCACGCGCCTACAA
GGCCGCCATCGCCGAAGGCGAAGTGCCGGTGGAGCGGATCGTGAAGGACGTCGAGAAGACGCCCTCGGAC
TTCTACGTCGCCCAGCGTGACAGCCTGAAGGCGGCCGAGGCGGCGGCGCACGCGCTGGGCGCGGCGCTGG
ACCGGCTCGCCGGCCGCAACGCTCCCGCCCTCTCCCGTATCAAGCGCACGGTCGAGGAGCTGTGCCGGTT
CCAGGAGGATGTCTTGCGCAAACGTGGTGTCACCCTCGAACCGACCGCGTCTGTCGCCGCGCCCGAAGCC
GCATCCGAAGCCGCCGGAACCGGCGATGCCGCCACGACGCCGGGTGCTGCGGCGCATCCGGCTGGGGCCG
CCTGGACCGGCGGTCCGCGCAACCGGGAAGAGGCGTATGGAATGCTCCGGCAGATCGCCGACTATCTGGA
GCAGGAGGAACCGCACAGCCCGACCTCCTATCTGGTGCGCCGTGCGGCCTCCTGGGGTCAATTGTCGTTG
CCGGAACTCTATGCCGACCTGCTGGGCGACCGTGGCGAGGTTGGGAGGATGTTCTCCGTGCTGCGCTTGA
AGGACGAGTGA