SecReT6
Protein ID: 288959895
SecReT6 ID379
T6SS typei4a
Gene symbol-
Locus tagAZL_a01600
StrainAzospirillum sp. B510
Repliconplasmid pAB510a [GenBank: NC_013855] [Browse all T6SS(s) in this replicon]
Location [Strand]184843..185601 [-]
Producthypothetical protein
NoteTssL
UniProt IDD3NZ62
KEGG IDazl:AZL_a01600
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 5.20E-28, Aligned region: 42..223
Protein Sequence: 252 a.a.     [Download]
>gi|288959895|ref|YP_003450235.1| hypothetical protein AZL_a01600 [Azospirillum sp. B510]
MLVLSAIHAPAGHAPAGFAARPGMGEASAPPVLPLEPDAEIIIRRLEDFLEAQAAQVARTGTELMISQYR
EAQYAMAALADDLFIHDVEWNGREVWRSALLEHALFRTRLAGERVFDRMEALLASDDHRLSQLAAVYLLL
LGLGFKGRYRESGGAVQLRSISARLFEFIAGRESELAPGLLPAGRTLIPSAYAHTMTDRQMRTLARGVRW
PVVLAALAGAWLVVGQAMWWVTTANLSSAADAVMQASVRVTR
 
Nucleotide Sequence: 759 bp     [Download]
>gi|288959735|ref|NC_013855.1|:c185601-184843 Azospirillum sp. B510 plasmid pAB510a, complete sequence
GTGCTCGTCCTGTCGGCCATCCATGCGCCCGCCGGCCATGCGCCCGCCGGTTTTGCGGCCCGGCCGGGAA
TGGGCGAGGCGTCGGCCCCGCCGGTGCTGCCGCTCGAACCCGATGCGGAGATCATCATCCGCCGCCTGGA
GGACTTTCTGGAAGCCCAGGCGGCGCAGGTCGCGCGCACCGGCACCGAACTGATGATCAGCCAGTACCGC
GAGGCGCAATACGCCATGGCGGCGCTGGCCGACGACCTGTTCATCCACGACGTGGAATGGAACGGGCGGG
AGGTCTGGCGCTCCGCGCTGCTGGAGCACGCGCTGTTCCGCACCCGGCTTGCCGGTGAGCGCGTCTTCGA
CCGCATGGAGGCGCTGCTGGCCAGCGACGACCACCGGCTGTCGCAGCTCGCCGCGGTGTATCTCCTATTG
CTCGGCCTGGGCTTCAAGGGCCGTTACCGCGAATCCGGCGGCGCGGTTCAACTCCGCAGCATCTCCGCCC
GCCTATTCGAGTTCATCGCCGGACGGGAGTCCGAACTCGCTCCGGGCCTGCTGCCGGCCGGGCGAACGCT
GATCCCGTCCGCATACGCCCACACCATGACCGACAGGCAGATGCGCACGCTGGCGCGCGGCGTGCGCTGG
CCGGTGGTGCTGGCCGCCCTGGCCGGGGCGTGGCTGGTGGTTGGTCAGGCGATGTGGTGGGTGACCACGG
CGAACCTGTCGAGCGCGGCGGACGCGGTGATGCAGGCGTCCGTCCGCGTGACGCGCTGA