SecReT6
Protein ID: 288959896
SecReT6 ID379
T6SS typei4a
Gene symbol-
Locus tagAZL_a01610
StrainAzospirillum sp. B510
Repliconplasmid pAB510a [GenBank: NC_013855] [Browse all T6SS(s) in this replicon]
Location [Strand]185768..187111 [-]
Producthypothetical protein
NoteTssK
UniProt IDD3NZ63
KEGG IDazl:AZL_a01610
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.30E-55, Aligned region: 23..392
Protein Sequence: 447 a.a.     [Download]
>gi|288959896|ref|YP_003450236.1| hypothetical protein AZL_a01610 [Azospirillum sp. B510]
MTEARDIPEAIAWHDGMLLAPQHFQQQALRNERLLTYHAGHARPFHWGVVHLQVDRVHLVSGLVRIRELE
AIMPDGLVVHYAGDRTEPLEVDISAYADPVGQTQITIHLIVPQALADRAPGPGEVSRFLSVEGRPVPDLN
GGEEVAIARLRPRLGLFATTGPNQKPPQKFVSMPVGRATFRNDAFVLTDFVPPTLSVAANSALGRLGGEI
VRRVREKALFLAERSGVGTGNAATELADAARAEIRSLVTGLPTLEAQLAVGVCHPFDVYLSLCTLAGHLS
AFANGAVPAKLSRYDHDDPMSAYGEVRDFILRMIDRVKEGVARIPFTFEAGMFGLVMEEAWLKGRLVIGV
RGPAASTVGEVAAWMENCIVASHSKLETLSGLRVKGADRIALDDSGESGVAAPRGVVPFEVVVDPRYVVP
GERLEIWNPDSIGSRFRPVEITLFVTA
 
Nucleotide Sequence: 1344 bp     [Download]
>gi|288959735|ref|NC_013855.1|:c187111-185768 Azospirillum sp. B510 plasmid pAB510a, complete sequence
ATGACCGAGGCGCGCGATATTCCCGAGGCCATCGCCTGGCACGACGGTATGCTGCTGGCCCCGCAGCACT
TCCAGCAGCAGGCCCTGCGCAACGAGCGGCTGCTGACCTACCATGCCGGCCATGCCCGCCCCTTCCATTG
GGGCGTCGTGCACCTTCAGGTGGACCGCGTTCATCTGGTGTCCGGGCTGGTGCGTATCCGCGAGCTGGAA
GCGATCATGCCCGACGGGCTGGTTGTCCATTACGCCGGCGACCGCACCGAACCGTTGGAGGTGGACATCT
CCGCCTATGCCGACCCGGTCGGCCAGACGCAGATCACCATCCATCTGATCGTTCCGCAGGCGCTTGCCGA
CCGCGCGCCGGGGCCCGGCGAAGTCTCGCGCTTCCTCTCGGTCGAGGGGCGCCCGGTTCCCGACCTCAAC
GGCGGCGAGGAGGTGGCCATCGCCCGCCTGCGCCCGCGTCTTGGTCTGTTCGCCACCACCGGTCCGAACC
AGAAGCCGCCGCAGAAGTTCGTATCGATGCCCGTCGGCCGGGCGACCTTTCGCAACGATGCCTTCGTGCT
GACCGACTTCGTGCCGCCGACGCTGTCGGTGGCCGCCAACTCGGCGCTCGGCCGTCTGGGGGGGGAGATC
GTGCGCCGCGTGCGCGAAAAGGCGCTGTTCCTGGCCGAACGCTCCGGCGTCGGCACGGGCAACGCCGCGA
CCGAACTGGCCGACGCCGCCCGCGCCGAAATCCGCAGCCTCGTCACCGGACTGCCGACGCTGGAGGCGCA
GCTCGCCGTCGGCGTCTGCCATCCCTTCGATGTCTATCTCTCGCTGTGCACTCTGGCCGGCCACCTCTCG
GCCTTCGCCAACGGCGCCGTGCCGGCCAAACTGTCGCGCTACGATCATGACGACCCGATGTCGGCCTATG
GCGAGGTGCGCGACTTCATCCTGCGCATGATCGACCGCGTCAAGGAAGGCGTCGCCCGCATCCCCTTCAC
CTTCGAGGCCGGGATGTTCGGTCTGGTGATGGAGGAGGCTTGGCTGAAGGGCCGGCTGGTCATCGGCGTG
CGCGGCCCGGCCGCCTCGACCGTGGGCGAGGTCGCGGCCTGGATGGAGAACTGCATCGTCGCCTCCCATT
CCAAGCTGGAGACGCTCTCCGGCCTGCGGGTGAAGGGTGCCGACCGCATCGCGCTCGACGACAGCGGCGA
GTCCGGTGTCGCCGCGCCGCGTGGCGTCGTGCCGTTCGAGGTCGTGGTGGATCCCCGCTACGTCGTCCCC
GGCGAGCGGCTGGAAATCTGGAACCCGGACAGCATCGGCAGCCGCTTCCGGCCCGTCGAGATCACGCTGT
TCGTCACGGCCTGA