SecReT6
Protein ID: 288959898
SecReT6 ID379
T6SS typei4a
Gene symbol-
Locus tagAZL_a01630
StrainAzospirillum sp. B510
Repliconplasmid pAB510a [GenBank: NC_013855] [Browse all T6SS(s) in this replicon]
Location [Strand]187576..188385 [-]
Producthypothetical protein
NoteSPOR
UniProt IDD3NZ65
KEGG IDazl:AZL_a01630
PDB IDNA
Domain hit(s) vs Pfam SPOR [PF05036], Evalue: 6.70E-09, Aligned region: 187..260
Protein Sequence: 269 a.a.     [Download]
>gi|288959898|ref|YP_003450238.1| hypothetical protein AZL_a01630 [Azospirillum sp. B510]
MAMRTITLRRGQMAGLAIGVAVLMVVAMLLGVGLSVAMMGPELVTQVAAGVVPGAAPAAGSPAAASPPIA
ALAGEGRFAGVADTLGMNSISRRFKTEQAIKATADRAADTVSGVTETVLDPVAQGTLAAAGRFLPSWMAA
PVTKSVNRASFQARSKLSYGVENGVEDRLFNGLDHVTKAGDAAPVRSFAVELGRFANQANAESFATAAGQ
RGVSAAVSYAPDGGATMPYAVRSGRFATPDEATAAVDAIKRSSGVAGTIVTLAEPGGRS
 
Nucleotide Sequence: 810 bp     [Download]
>gi|288959735|ref|NC_013855.1|:c188385-187576 Azospirillum sp. B510 plasmid pAB510a, complete sequence
ATGGCGATGAGGACGATTACGCTGAGGCGGGGACAGATGGCCGGACTGGCCATCGGCGTTGCCGTGCTCA
TGGTTGTCGCCATGCTGTTGGGCGTCGGACTCTCCGTGGCGATGATGGGACCTGAGCTGGTTACGCAGGT
CGCCGCCGGCGTGGTCCCCGGTGCCGCTCCTGCCGCAGGCAGTCCGGCCGCCGCTTCCCCGCCCATCGCC
GCTCTGGCCGGCGAGGGCCGGTTTGCCGGTGTCGCCGACACTCTGGGCATGAACTCAATCTCGCGCCGTT
TCAAGACCGAACAGGCGATCAAGGCCACCGCTGACCGTGCCGCGGACACCGTTTCGGGCGTGACGGAGAC
GGTGCTGGATCCGGTTGCCCAGGGCACGCTCGCCGCCGCTGGTCGCTTTCTTCCCTCCTGGATGGCCGCG
CCGGTGACCAAGTCCGTGAACCGCGCCTCTTTCCAGGCGCGCAGCAAGCTGTCCTATGGCGTCGAGAACG
GCGTCGAGGACCGTCTCTTCAACGGGCTCGACCACGTGACAAAGGCGGGCGATGCGGCCCCCGTGCGCAG
CTTCGCGGTCGAGCTGGGCCGCTTCGCCAACCAAGCCAACGCAGAGAGCTTCGCCACCGCCGCCGGCCAG
CGGGGTGTTTCCGCCGCCGTGTCCTACGCGCCCGACGGTGGGGCCACGATGCCGTACGCCGTACGCAGCG
GCCGTTTCGCCACCCCCGACGAGGCGACCGCGGCTGTGGATGCCATCAAGCGGTCCAGCGGTGTGGCCGG
CACCATCGTTACCCTAGCCGAGCCGGGAGGACGGTCCTGA