SecReT6
Protein ID: 288959899
SecReT6 ID379
T6SS typei4a
Gene symbol-
Locus tagAZL_a01640
StrainAzospirillum sp. B510
Repliconplasmid pAB510a [GenBank: NC_013855] [Browse all T6SS(s) in this replicon]
Location [Strand]188636..189214 [-]
Producthypothetical protein
NoteSPOR
UniProt IDD3NZ66
KEGG IDazl:AZL_a01640
PDB IDNA
Domain hit(s) vs Pfam SPOR [PF05036], Evalue: 1.20E-12, Aligned region: 111..183
Protein Sequence: 192 a.a.     [Download]
>gi|288959899|ref|YP_003450239.1| hypothetical protein AZL_a01640 [Azospirillum sp. B510]
MRRCQDRLGGGAMKKLLLAVPVLLLLVVAFSGGYYLAGGGRPGVTAQAGKDGPAPAEAANGNGSAGAPAG
GQADVRGGAKAAEAKDASGEAPPADIPVRPAAAAVRGGMVYSIELGAFRSPDNARSFAGVMRQRGLPVVI
VEAVDATGRPWLRVRAGSFADLWQAEARRPEYERIAGIGGVVVGETSPATPP
 
Nucleotide Sequence: 579 bp     [Download]
>gi|288959735|ref|NC_013855.1|:c189214-188636 Azospirillum sp. B510 plasmid pAB510a, complete sequence
GTGCGCCGGTGCCAGGACCGTCTCGGCGGAGGGGCGATGAAGAAGCTCCTCCTCGCCGTGCCGGTCCTGC
TGCTGCTCGTGGTGGCGTTCAGCGGCGGTTACTATCTGGCCGGCGGCGGGCGTCCGGGCGTCACCGCCCA
AGCCGGCAAGGATGGTCCGGCGCCCGCAGAGGCCGCCAATGGCAATGGTTCGGCCGGCGCTCCGGCCGGC
GGCCAAGCCGACGTCCGGGGCGGTGCCAAGGCGGCGGAAGCCAAGGATGCGTCCGGAGAAGCCCCGCCGG
CCGATATCCCGGTCAGGCCCGCTGCGGCGGCGGTCAGGGGAGGCATGGTCTACTCCATCGAACTGGGCGC
CTTCCGCTCGCCCGATAATGCGAGGTCCTTTGCCGGCGTGATGCGGCAGCGCGGTCTTCCCGTGGTCATC
GTCGAGGCGGTCGATGCCACCGGCCGGCCCTGGCTGCGCGTACGCGCCGGCAGTTTCGCCGACCTGTGGC
AAGCCGAGGCGCGCCGGCCGGAGTATGAGAGAATCGCGGGGATCGGCGGCGTGGTGGTCGGCGAAACCTC
CCCTGCCACGCCTCCTTGA