SecReT6
Protein ID: 288959905
SecReT6 ID379
T6SS typei4a
Gene symbol-
Locus tagAZL_a01700
StrainAzospirillum sp. B510
Repliconplasmid pAB510a [GenBank: NC_013855] [Browse all T6SS(s) in this replicon]
Location [Strand]196189..196731 [+]
Producthypothetical protein
NoteTssB
UniProt IDD3NZ72
KEGG IDazl:AZL_a01700
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.80E-52, Aligned region: 9..161
Protein Sequence: 180 a.a.     [Download]
>gi|288959905|ref|YP_003450245.1| hypothetical protein AZL_a01700 [Azospirillum sp. B510]
MSESIQKKLESVRPPRVKLMYEVHTGGATEMKELPFLVGVLADLSGKPEKPLPKLKERKFVEVDRDNFND
VLASTAPRLAFQVDNKLQADGGKLNVLLNFEDMGDFEPVQVLNQMPALARLFEARQKLSDLLAKLDGNDE
LSGLLNDVIANTEQQDELKKLLGPAETAMAPAPMEEPPAA
 
Nucleotide Sequence: 543 bp     [Download]
>gi|288959735|ref|NC_013855.1|:196189-196731 Azospirillum sp. B510 plasmid pAB510a, complete sequence
ATGTCCGAGAGCATCCAGAAGAAATTGGAGAGTGTCCGTCCGCCGCGCGTCAAGCTGATGTACGAGGTTC
ACACCGGCGGCGCCACCGAGATGAAGGAGCTTCCGTTCCTCGTCGGCGTCCTCGCCGACCTGAGCGGCAA
GCCGGAAAAGCCGCTCCCGAAGCTGAAGGAGCGGAAGTTCGTCGAGGTCGATCGCGACAATTTCAACGAC
GTTCTGGCCTCCACCGCTCCACGGCTGGCGTTCCAGGTCGACAACAAGCTTCAGGCCGACGGCGGCAAGC
TCAATGTGCTGCTGAACTTCGAGGACATGGGCGATTTCGAGCCGGTCCAGGTTCTGAACCAGATGCCGGC
GCTGGCCCGCCTGTTCGAAGCCCGGCAGAAGCTGTCCGATCTACTGGCGAAGCTGGACGGCAACGACGAG
CTGAGCGGCCTGCTCAACGACGTCATTGCCAACACCGAGCAGCAGGACGAGCTGAAGAAGCTCCTCGGCC
CCGCGGAAACGGCGATGGCGCCGGCTCCCATGGAAGAGCCCCCGGCCGCCTGA