SecReT6
Protein ID: 288959906
SecReT6 ID379
T6SS typei4a
Gene symbol-
Locus tagAZL_a01710
StrainAzospirillum sp. B510
Repliconplasmid pAB510a [GenBank: NC_013855] [Browse all T6SS(s) in this replicon]
Location [Strand]196778..198247 [+]
Producthypothetical protein
NoteTssC
UniProt IDD3NZ73
KEGG IDazl:AZL_a01710
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 4.80E-191, Aligned region: 63..485
Protein Sequence: 489 a.a.     [Download]
>gi|288959906|ref|YP_003450246.1| hypothetical protein AZL_a01710 [Azospirillum sp. B510]
MTTEMSVESTASVNLLDRMMVEGKMAREVGQRPYARDLLAEFVDQVVAETGDAVAIDVVEAINHRIAQID
ELISLQLNEILHHEEFQKLEATWRGLNYLVTNTEAGTQLKIRVLNTSRKDLQKDLDSAVEFDQSALFKMV
YEAEYGTLGGTPYSVLIGDYEFSRHPQDMSLLEKISNVAAAAHAPFIAAASPKMFDMDSFSELAGPRDLS
KIFETAEMVKWRSFRASEDSRYVALVMPHTLLRLPYGPKTAPVEGVNFVEDVDGRDHSKYLWGNASWALG
VRITEAFAKYGWTAAIRGVEGGGRVSGLPTHTFKTDEGDVALKCPTEIAITDRREKELNDLGFISLVHCK
NTDYAAFFGGQTANKPKVYNTDEANANARLSAMLPYMLVSSRFAHYLKVMLRDKIGSFVTRGNVQNYLNT
WIGNYILLDDDASQDMKARFPLREARVDVYEVPGRPGVYRANVFLRPHFQLEELSASIRLVAELPAPEA
 
Nucleotide Sequence: 1470 bp     [Download]
>gi|288959735|ref|NC_013855.1|:196778-198247 Azospirillum sp. B510 plasmid pAB510a, complete sequence
GTGACCACGGAAATGTCCGTTGAGAGCACCGCCAGCGTCAACCTGCTCGACCGCATGATGGTCGAGGGCA
AGATGGCCCGTGAAGTGGGTCAGCGGCCCTACGCCCGCGATCTGCTTGCCGAGTTCGTGGACCAGGTCGT
CGCCGAGACCGGCGACGCCGTCGCCATCGACGTCGTCGAGGCGATCAACCACCGCATCGCCCAAATCGAC
GAGCTGATCAGCCTTCAGCTGAACGAGATCCTGCACCATGAGGAATTCCAGAAGCTGGAAGCCACCTGGC
GCGGTCTGAACTACCTCGTTACGAACACCGAGGCCGGCACGCAGCTGAAGATCCGCGTGCTGAACACCTC
GCGCAAGGACCTGCAGAAGGATCTGGACAGCGCGGTCGAGTTCGACCAGAGCGCCCTGTTCAAGATGGTC
TACGAGGCCGAATACGGCACACTCGGCGGCACGCCCTACAGCGTGCTCATCGGCGACTACGAGTTCAGCC
GCCATCCGCAGGACATGTCGCTGCTCGAGAAGATCTCGAACGTCGCCGCCGCAGCCCACGCGCCGTTCAT
CGCCGCCGCCTCGCCCAAGATGTTCGACATGGACAGCTTCTCCGAGCTGGCCGGTCCGCGCGACCTGTCG
AAGATCTTCGAGACCGCCGAGATGGTGAAGTGGCGCTCCTTCCGCGCATCGGAAGACTCGCGCTACGTCG
CCCTCGTCATGCCGCACACGCTGCTCCGCCTCCCCTACGGCCCGAAGACGGCGCCGGTCGAAGGCGTGAA
CTTCGTCGAGGACGTGGACGGACGCGACCATTCCAAGTACCTGTGGGGCAACGCTTCGTGGGCGCTCGGC
GTGCGCATCACCGAAGCCTTCGCCAAGTATGGCTGGACGGCGGCCATCCGTGGCGTCGAGGGCGGCGGCC
GGGTCAGCGGCCTGCCCACCCACACCTTCAAGACGGATGAGGGCGACGTCGCCCTGAAATGCCCGACCGA
GATCGCCATCACGGACCGTCGCGAGAAGGAGCTGAACGACCTCGGCTTCATTTCGCTGGTGCACTGCAAG
AACACCGATTACGCGGCGTTCTTCGGGGGCCAGACGGCGAACAAGCCGAAGGTGTACAATACCGACGAGG
CCAATGCGAACGCGCGGCTCTCGGCGATGCTGCCGTACATGCTCGTGTCGTCGCGTTTCGCGCATTACCT
GAAGGTCATGCTGCGCGACAAGATCGGCTCGTTCGTCACCCGCGGCAACGTGCAGAACTACCTCAACACC
TGGATCGGCAACTACATCCTGCTGGACGACGACGCCTCCCAGGATATGAAGGCGCGCTTCCCGCTGCGCG
AGGCACGGGTGGACGTCTACGAGGTGCCGGGCCGTCCCGGCGTTTACCGCGCCAACGTGTTCCTGCGCCC
GCACTTCCAGCTTGAGGAACTGTCGGCCTCGATCCGGCTGGTTGCCGAGCTGCCCGCGCCGGAAGCCTGA