SecReT6
Protein ID: 288959907
SecReT6 ID379
T6SS typei4a
Gene symbol-
Locus tagAZL_a01720
StrainAzospirillum sp. B510
Repliconplasmid pAB510a [GenBank: NC_013855] [Browse all T6SS(s) in this replicon]
Location [Strand]198295..198804 [+]
Producthypothetical protein
NoteTssD
UniProt IDD3NZ74
KEGG IDazl:AZL_a01720
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.60E-13, Aligned region: 6..142
Synapsin [PF02078], Evalue: 0.0052, Aligned region: 10..58
Protein Sequence: 169 a.a.     [Download]
>gi|288959907|ref|YP_003450247.1| hypothetical protein AZL_a01720 [Azospirillum sp. B510]
MSMVILEIPEVRGECRVKTKQVDFTNMILCESLSQDMEVEMEVTTNARRTVHTPKVNNITLDRKWDIASP
KLISLLLRAGVKGETWKIHCVKPLGDDEFQWVEFLTLELTNPLLAKHSLNVSEGDTTENLEINATKITWV
YKQYDEKQTNQGGGGVSFDLLTGAVGGAS
 
Nucleotide Sequence: 510 bp     [Download]
>gi|288959735|ref|NC_013855.1|:198295-198804 Azospirillum sp. B510 plasmid pAB510a, complete sequence
ATGTCCATGGTCATCCTGGAAATCCCCGAGGTCAGGGGCGAGTGCCGGGTCAAGACGAAGCAGGTCGACT
TCACCAACATGATCCTCTGCGAATCGCTCTCGCAGGATATGGAAGTCGAAATGGAAGTGACGACGAATGC
GCGGCGCACCGTCCACACGCCGAAGGTCAACAACATCACGCTGGACCGCAAATGGGACATTGCGTCTCCC
AAGCTCATCAGCCTGTTGCTGCGGGCCGGCGTGAAGGGCGAGACATGGAAGATCCATTGTGTCAAGCCGC
TGGGCGACGACGAGTTCCAGTGGGTCGAGTTCCTCACCCTGGAGCTGACCAACCCGCTTCTGGCGAAGCA
CTCGCTGAACGTCAGCGAGGGCGACACTACGGAGAACCTGGAGATCAACGCCACGAAGATCACCTGGGTC
TACAAGCAGTACGACGAGAAGCAGACCAACCAGGGCGGCGGCGGCGTCTCGTTCGATCTGCTCACCGGCG
CGGTCGGCGGCGCCAGCTGA