SecReT6
Protein ID: 288959908
SecReT6 ID379
T6SS typei4a
Gene symbol-
Locus tagAZL_a01730
StrainAzospirillum sp. B510
Repliconplasmid pAB510a [GenBank: NC_013855] [Browse all T6SS(s) in this replicon]
Location [Strand]198877..199434 [+]
Producthypothetical protein
NoteTssE
UniProt IDD3NZ75
KEGG IDazl:AZL_a01730
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 4.40E-15, Aligned region: 61..157
Protein Sequence: 185 a.a.     [Download]
>gi|288959908|ref|YP_003450248.1| hypothetical protein AZL_a01730 [Azospirillum sp. B510]
MQGRAGAGVATLRAIGRQRIGTPAMTQSKAMNGGRTLLFERLIDFEPENPSADDPSMIVMSMTDLTASIQ
REIRRLLDSRAAGGRRSDIGGTVMEYGLPDFGDIHPRSFTDRRRVETAVRHAILDFEPRLLRPRIVVTPG
EGNGTLTLEITGEVAAGTVVEPLIFSVNLGAAPLAPTACFAAGTG
 
Nucleotide Sequence: 558 bp     [Download]
>gi|288959735|ref|NC_013855.1|:198877-199434 Azospirillum sp. B510 plasmid pAB510a, complete sequence
ATGCAGGGCAGGGCAGGGGCGGGCGTTGCAACGCTCCGAGCGATCGGACGTCAAAGAATCGGAACCCCGG
CGATGACACAGTCCAAGGCGATGAACGGCGGGCGCACGCTGCTCTTCGAGCGCCTGATCGATTTCGAGCC
GGAAAACCCGTCGGCCGACGATCCGTCCATGATCGTCATGTCCATGACCGACCTGACGGCCTCCATCCAG
CGCGAAATCCGGCGCTTGCTGGACAGCCGCGCCGCGGGCGGACGCCGGTCGGACATCGGCGGCACCGTGA
TGGAATATGGGTTGCCGGACTTCGGCGACATCCACCCGCGCTCCTTCACCGATCGCCGTCGGGTGGAGAC
CGCTGTCCGCCATGCCATCCTCGATTTCGAGCCGCGCCTCCTCCGGCCGCGCATCGTGGTGACGCCGGGC
GAAGGCAACGGGACGCTGACGCTGGAAATCACGGGTGAAGTGGCCGCCGGAACCGTCGTCGAACCGCTGA
TCTTTTCCGTGAATCTGGGGGCCGCACCCCTGGCGCCAACCGCCTGCTTCGCCGCCGGGACCGGTTGA