SecReT6
Protein ID: 288959909
SecReT6 ID379
T6SS typei4a
Gene symbol-
Locus tagAZL_a01740
StrainAzospirillum sp. B510
Repliconplasmid pAB510a [GenBank: NC_013855] [Browse all T6SS(s) in this replicon]
Location [Strand]199436..201232 [+]
Producthypothetical protein
NoteTssF
UniProt IDD3NZ76
KEGG IDazl:AZL_a01740
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.30E-182, Aligned region: 6..598
Protein Sequence: 598 a.a.     [Download]
>gi|288959909|ref|YP_003450249.1| hypothetical protein AZL_a01740 [Azospirillum sp. B510]
MRREDLLEHYERELLYVRRAGEAFARSYPKIARRLALGPDQAADPNVERLIESFAFLTGRLQLNLDREFP
RFTEALLGILHPQLVAPVPPMGIAQMEPAPGNGQLTDGFTVPRGTALHALAEGSARCRFRTAYDVTLWPL
ALTEAAVEPTERYDFIDGGEAASVLRLRLETRNQVFENLPVESLRLFLNGEPVLNAALHELLLCGTVEIV
YLTPGKPPVRMRGDDLIRPVGFEPDQSVLPHPRHAQPAYGLLREYFEFPQKFDFYDLALPQGRLSGTVVE
VLILVSRPLPNRLTVRRDCFRLGCTPIVNLFTRSAEPVRLNHKHTSYRVVADAMRERTTEIHSVLEVTGM
RDADGARRTYVPLFSFQHASADADPRGFWLATREPTQREDMPGTDVYLGLHHLDLNPAEPADETLLVRVA
CTNRGLAEQMPAGAVLMIEEAAPIAAIRCLNKPAAGRPAPISGMSAWKLVSHLSINHLSLTGDPEGLRAL
QAILGLYAQEEATAQNQLRGLNALSSRPVLHRIGQDAWRGFVRGLELTLDIDERNFVGASPLVFGGVLSR
FLGLYVNVNAFAQLRLRSVQRGGIWKTWPRLAGNQPVL
 
Nucleotide Sequence: 1797 bp     [Download]
>gi|288959735|ref|NC_013855.1|:199436-201232 Azospirillum sp. B510 plasmid pAB510a, complete sequence
ATGCGGCGCGAGGATCTCCTCGAACATTATGAGCGCGAATTGCTGTACGTCCGCCGGGCGGGCGAGGCGT
TCGCACGCAGCTACCCGAAGATCGCCCGGCGTCTGGCGCTCGGCCCCGACCAGGCGGCCGATCCCAACGT
CGAACGGCTGATCGAGTCCTTCGCTTTCCTGACCGGACGTCTGCAACTCAACCTCGACCGCGAGTTTCCG
CGCTTCACCGAGGCGTTGCTGGGCATCCTCCACCCGCAGCTGGTGGCGCCCGTGCCGCCCATGGGCATCG
CCCAGATGGAACCGGCGCCGGGCAACGGCCAGCTCACCGACGGCTTCACCGTGCCCCGCGGCACGGCGCT
GCACGCGCTGGCGGAAGGATCGGCGCGCTGCCGCTTCCGCACGGCCTACGATGTGACCCTGTGGCCGCTG
GCGCTGACCGAGGCCGCGGTGGAGCCAACCGAGCGTTACGACTTCATCGACGGCGGCGAGGCGGCCTCGG
TCCTGCGCCTGCGGCTGGAAACCCGCAATCAGGTTTTCGAGAACCTGCCGGTCGAAAGCCTGAGGCTGTT
CCTCAACGGCGAGCCGGTGCTGAATGCGGCGCTGCACGAGTTGCTGCTGTGCGGCACGGTGGAAATCGTC
TACCTGACGCCCGGCAAGCCGCCGGTGCGGATGCGCGGCGACGATCTGATCCGCCCCGTCGGCTTCGAAC
CCGACCAGAGCGTACTGCCGCATCCGCGGCATGCCCAGCCGGCCTACGGCCTGCTGCGGGAATATTTCGA
GTTCCCGCAGAAGTTCGACTTCTATGACCTGGCGCTGCCGCAAGGCCGGCTGTCAGGAACCGTGGTGGAG
GTGCTGATCCTGGTATCGCGCCCATTGCCCAACCGGCTGACGGTGCGCCGCGACTGTTTCCGGCTGGGCT
GCACACCGATCGTCAACCTGTTCACGCGCTCGGCCGAGCCGGTGCGGCTCAACCACAAGCACACCTCCTA
CCGCGTGGTGGCCGACGCCATGCGCGAGCGGACCACCGAGATCCACTCGGTGCTGGAGGTCACCGGCATG
CGCGACGCCGACGGCGCGCGCCGGACCTATGTGCCCCTGTTCTCCTTTCAGCATGCCAGCGCCGATGCCG
ACCCGCGCGGCTTCTGGCTGGCAACGCGCGAGCCGACCCAGCGCGAGGACATGCCGGGCACCGACGTCTA
TCTCGGCCTGCACCACCTCGACCTCAATCCGGCGGAGCCGGCGGACGAAACGCTGCTGGTGCGGGTTGCG
TGCACCAACCGCGGTCTGGCGGAGCAGATGCCGGCCGGTGCGGTGCTGATGATCGAGGAGGCGGCGCCCA
TCGCCGCCATCCGCTGCCTCAACAAGCCGGCCGCCGGCCGTCCCGCCCCGATCAGCGGCATGTCGGCGTG
GAAGCTGGTCTCGCACCTGTCGATCAACCACCTCAGCCTGACGGGCGATCCGGAAGGGTTGCGGGCGCTC
CAGGCCATCCTCGGGCTCTATGCGCAGGAAGAGGCAACGGCGCAGAATCAGCTGCGCGGCCTGAACGCGC
TGTCGTCGCGGCCCGTTCTGCACCGCATCGGCCAGGATGCCTGGCGCGGCTTCGTGCGTGGGCTGGAGCT
GACCCTGGACATCGACGAGCGCAATTTCGTGGGGGCGAGCCCGCTGGTGTTCGGCGGCGTGCTGAGCCGC
TTCCTCGGCCTCTACGTCAACGTCAACGCCTTCGCCCAGCTCCGGCTCCGCTCGGTGCAACGAGGAGGGA
TCTGGAAGACATGGCCACGCCTGGCAGGCAATCAGCCCGTCCTTTGA