SecReT6
Protein ID: 288959910
SecReT6 ID379
T6SS typei4a
Gene symbol-
Locus tagAZL_a01750
StrainAzospirillum sp. B510
Repliconplasmid pAB510a [GenBank: NC_013855] [Browse all T6SS(s) in this replicon]
Location [Strand]201196..202233 [+]
Producthypothetical protein
NoteTssG
UniProt IDD3NZ77
KEGG IDazl:AZL_a01750
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.40E-81, Aligned region: 18..322
Protein Sequence: 345 a.a.     [Download]
>gi|288959910|ref|YP_003450250.1| hypothetical protein AZL_a01750 [Azospirillum sp. B510]
MATPGRQSARPLIEALEAGPWGFDLFQAIALLERAAPDREPLGAGIDPDREAVRIEHDATLAFPASDVVS
ARRDEDGRGVVRSPVLGLGGAGGPLPYVATEMMLERVARRDTAGAAFYDIFNHRMISILYRTRQGSLPLL
ERDPERSLLARALRSLVGIGTASLEERLPGAPDRMLLAFSGILSCRVRSAAGLETMIGAIFQVETRVKGF
VGRWLPLGEEATTVVSAGRRGRNNRLGRDVVIGGRVWDQQTCYEIELKVDSLERYRDFLPSGRHHATLCA
LARFHSGEGMDFQISLVLSPPMVPHTRLSACNGSLLGWTSWLRFPNTPSRTTGRLTLPPAIGGTP
 
Nucleotide Sequence: 1038 bp     [Download]
>gi|288959735|ref|NC_013855.1|:201196-202233 Azospirillum sp. B510 plasmid pAB510a, complete sequence
ATGGCCACGCCTGGCAGGCAATCAGCCCGTCCTTTGATCGAGGCGCTGGAGGCCGGGCCCTGGGGGTTCG
ACCTGTTCCAGGCCATCGCGTTGCTGGAACGCGCCGCACCGGACCGCGAGCCTCTGGGGGCGGGCATCGA
CCCCGATCGCGAGGCCGTGCGCATCGAACACGACGCCACCCTCGCCTTTCCAGCCAGCGACGTGGTGTCG
GCGCGGCGGGATGAGGACGGGCGCGGGGTCGTGCGCTCGCCGGTGCTGGGGCTGGGCGGGGCGGGAGGCC
CTCTGCCCTATGTCGCCACCGAGATGATGCTGGAGCGCGTGGCACGCCGCGACACGGCGGGCGCCGCCTT
CTACGACATCTTCAACCACCGTATGATATCGATCCTCTACCGGACGCGGCAGGGCAGCCTGCCGTTGCTG
GAGCGCGATCCAGAGCGATCGCTGTTGGCGCGGGCGCTGCGTTCCCTGGTGGGCATCGGCACCGCCTCCC
TGGAAGAGCGGCTGCCGGGTGCGCCGGACCGCATGCTGCTGGCCTTTTCCGGCATTCTGTCCTGCCGGGT
GCGCTCGGCCGCCGGGCTGGAAACGATGATCGGCGCCATCTTCCAGGTGGAGACGCGGGTCAAGGGGTTC
GTCGGCCGCTGGCTTCCGCTGGGCGAAGAGGCGACGACCGTCGTCAGCGCCGGGCGGCGCGGACGCAACA
ACCGGCTGGGTCGGGACGTGGTGATCGGAGGGCGCGTCTGGGACCAGCAGACCTGCTACGAGATCGAGCT
GAAGGTGGACTCGCTGGAACGGTACCGCGACTTCCTGCCCAGCGGCCGCCACCACGCCACACTGTGCGCG
CTCGCCCGCTTCCACAGCGGCGAGGGCATGGATTTCCAGATCTCCCTGGTGCTGAGCCCGCCGATGGTGC
CGCACACCCGCCTCTCGGCTTGCAACGGCAGCCTGCTCGGCTGGACGTCCTGGCTGCGCTTCCCCAACAC
GCCAAGCCGGACAACCGGCCGGCTCACCCTTCCACCCGCGATCGGGGGCACTCCGTGA