SecReT6
Protein ID: 288959911
SecReT6 ID379
T6SS typei4a
Gene symbol-
Locus tagAZL_a01760
StrainAzospirillum sp. B510
Repliconplasmid pAB510a [GenBank: NC_013855] [Browse all T6SS(s) in this replicon]
Location [Strand]202383..203465 [+]
Producthypothetical protein
NoteTssH
UniProt IDD3NZ78
KEGG IDazl:AZL_a01760
PDB IDNA
Domain hit(s) vs Pfam ClpB_D2-small [PF10431], Evalue: 0.00042, Aligned region: 84..124
Protein Sequence: 360 a.a.     [Download]
>gi|288959911|ref|YP_003450251.1| hypothetical protein AZL_a01760 [Azospirillum sp. B510]
MVGILRQYEIDAARIETELNAAVKRSVRHIPARQLPDKAISVLDTARARVAVARTSKPEAIEALEREDQM
PARDAERLEREAGAALDAVVRRATHSDAGARMIDTLLSEFVMPEVAMRILDQVAAGRPVGAIRVDCDSDG
RFTVTVAPATGAAEPALARAAAEREEAARGKNERAFLTGPTAPVDLDSVRTRQGDLAQHRGRGTALVALL
LSGDHDLVGRRHRFRPDRRQAGDGDPDAGRRHHQTLHQRHRRPHRADAHRRPRFHRALRGGTASLAVDAD
PFRRLPHLPGKDRAGNRRGGDRLRRHHQEGAERYLSHPRILRSVPRDRLQLHRQAAGRGRHLLFLRACRR
QTQAGSGRRR
 
Nucleotide Sequence: 1083 bp     [Download]
>gi|288959735|ref|NC_013855.1|:202383-203465 Azospirillum sp. B510 plasmid pAB510a, complete sequence
GTGGTCGGGATCCTGCGCCAATATGAAATTGACGCGGCACGGATCGAAACCGAGTTGAACGCGGCGGTGA
AGCGGTCGGTCCGCCACATCCCGGCGCGCCAGCTTCCCGACAAGGCGATCAGCGTGCTGGACACCGCCCG
CGCGCGGGTGGCGGTAGCCCGCACCTCCAAACCCGAAGCCATCGAGGCGCTGGAGCGAGAGGACCAGATG
CCTGCCCGCGACGCCGAGCGGCTGGAGCGCGAGGCCGGGGCGGCGCTCGATGCAGTGGTGCGGCGGGCCA
CGCATTCCGATGCGGGCGCCCGTATGATCGACACGCTGCTGTCGGAGTTCGTGATGCCCGAAGTGGCTAT
GCGGATCCTCGACCAGGTGGCCGCCGGCCGGCCGGTGGGCGCGATCCGGGTCGATTGCGACAGCGACGGG
CGTTTCACCGTGACCGTCGCCCCGGCCACCGGAGCGGCGGAACCGGCGCTCGCCCGAGCGGCCGCGGAAC
GAGAAGAGGCTGCACGAGGGAAGAATGAGCGAGCGTTTCTCACAGGCCCAACAGCACCTGTCGATCTCGA
CTCCGTTAGGACCCGACAAGGTGATCTTGCGCAACATCGCGGGCGAGGAACGGCTCTCGTCGCTCTTCTC
CTATCGGGTGACCATGATCTCGTCGGACGACGACATCGATTTCGACCAGATCGTCGGCAAGCCGGTGACG
GTGACCCTGACGCTGGGCGACGGCACCACCAAACGCTACATCAACGCCATCGTCGGCCGCATCGAGCTGA
CGCACATCGACGACCGCGATTTCACCGCGCATTACGAGGCGGAACTGCATCCCTGGCTGTGGATGCTGAC
CCATTCCGGCGATTGCCGCATCTTCCAGGAAAAGACCGTGCCGGAAATCGTCGAGGCGGTGATAGGCTCC
GCCGGCACCATCAAGAAGGTGCTGAACGGTACCTATCCCACCCGCGAATATTGCGTTCAGTACCGCGAGA
CCGACTACAACTTCATCGCCAGGCTGCTGGAAGAGGAAGGCATCTTCTATTTCTTCGAGCATGCCGACGG
CAAACACAGGCTGGTTCTGGGCGACGGCGATAG