SecReT6
Protein ID: 288959912
SecReT6 ID379
T6SS typei4a
Gene symbol-
Locus tagAZL_a01770
StrainAzospirillum sp. B510
Repliconplasmid pAB510a [GenBank: NC_013855] [Browse all T6SS(s) in this replicon]
Location [Strand]202897..204990 [+]
Producthypothetical protein
NoteTssI
UniProt IDD3NZ79
KEGG IDazl:AZL_a01770
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.80E-77, Aligned region: 31..327
Phage_base_V [PF04717], Evalue: 1.50E-24, Aligned region: 358..450
Gp5_C [PF06715], Evalue: 2.50E-07, Aligned region: 493..515
Gp5_C [PF06715], Evalue: 2.50E-07, Aligned region: 516..539
Gp5_C [PF06715], Evalue: 2.50E-07, Aligned region: 541..558
Gp5_C [PF06715], Evalue: 2.50E-07, Aligned region: 558..576
Gp5_C [PF06715], Evalue: 2.50E-07, Aligned region: 576..591
Gp5_C [PF06715], Evalue: 2.50E-07, Aligned region: 628..640
Protein Sequence: 697 a.a.     [Download]
>gi|288959912|ref|YP_003450252.1| hypothetical protein AZL_a01770 [Azospirillum sp. B510]
MSERFSQAQQHLSISTPLGPDKVILRNIAGEERLSSLFSYRVTMISSDDDIDFDQIVGKPVTVTLTLGDG
TTKRYINAIVGRIELTHIDDRDFTAHYEAELHPWLWMLTHSGDCRIFQEKTVPEIVEAVIGSAGTIKKVL
NGTYPTREYCVQYRETDYNFIARLLEEEGIFYFFEHADGKHRLVLGDGDSAFTTSSLVSAYEYRGHEAYD
NEDNVFTQLGVERRVTTKSVGVDSYHFETPSTDLYAMAEGTSGTGTMNDYAVRHTVSADGEQIALVRQQA
LAFSGQRIRGGGSCRGLEAGTKITISGHRKDSLNAEMVLNSVRIEGATNRFVTTFTGFPSAHPFRPFNTA
RKPRIHSTQTAKVVGKSGEEIWLDKYGRIKVQFHWDRLGTNDEKSSCWVRVAQGWAGKNYGIMFLPRVGQ
EVVVTFLDGDPDRPLVTGAVYNAEQTVPYTLPDDSTKCTIKTQTSKNGMGKFNEIRFEDKADNEEIFVQA
QKDMNIKVLHDLTRLVKHDEVETIENDSAIDVKNDRTLTVRNNHSITVSEGNETHAVSRGTRDLSVKGKE
THVNDADFEHSVDKNYALTVKGNLTIDVTGDIVINGKSIKLTATSADIGIQAATGIGIKAGTSLDVKAGA
ATTVTSGTNMKIDAGMGATLKGGTTLDLKAGLALTAEGLSSTVKGAASAEVSGGGMLTLKGGVVMVN
 
Nucleotide Sequence: 2094 bp     [Download]
>gi|288959735|ref|NC_013855.1|:202897-204990 Azospirillum sp. B510 plasmid pAB510a, complete sequence
ATGAGCGAGCGTTTCTCACAGGCCCAACAGCACCTGTCGATCTCGACTCCGTTAGGACCCGACAAGGTGA
TCTTGCGCAACATCGCGGGCGAGGAACGGCTCTCGTCGCTCTTCTCCTATCGGGTGACCATGATCTCGTC
GGACGACGACATCGATTTCGACCAGATCGTCGGCAAGCCGGTGACGGTGACCCTGACGCTGGGCGACGGC
ACCACCAAACGCTACATCAACGCCATCGTCGGCCGCATCGAGCTGACGCACATCGACGACCGCGATTTCA
CCGCGCATTACGAGGCGGAACTGCATCCCTGGCTGTGGATGCTGACCCATTCCGGCGATTGCCGCATCTT
CCAGGAAAAGACCGTGCCGGAAATCGTCGAGGCGGTGATAGGCTCCGCCGGCACCATCAAGAAGGTGCTG
AACGGTACCTATCCCACCCGCGAATATTGCGTTCAGTACCGCGAGACCGACTACAACTTCATCGCCAGGC
TGCTGGAAGAGGAAGGCATCTTCTATTTCTTCGAGCATGCCGACGGCAAACACAGGCTGGTTCTGGGCGA
CGGCGATAGCGCGTTCACCACGAGTTCGCTGGTCTCCGCCTACGAGTATCGCGGGCACGAGGCCTACGAC
AACGAGGACAACGTTTTCACCCAGCTCGGCGTCGAGCGGCGGGTGACGACCAAAAGCGTCGGGGTGGACA
GCTATCACTTCGAGACGCCGTCGACCGACCTGTACGCCATGGCGGAGGGAACATCGGGAACCGGCACGAT
GAACGACTACGCGGTGCGCCACACCGTGTCCGCCGACGGCGAGCAGATCGCCCTGGTGCGTCAGCAGGCG
CTGGCCTTCTCCGGTCAACGCATCCGCGGTGGGGGGAGCTGCCGCGGGCTGGAAGCCGGCACCAAGATCA
CCATCTCCGGCCACCGCAAGGATTCGCTCAACGCGGAGATGGTGCTGAACTCCGTGCGCATCGAGGGGGC
GACCAACCGTTTCGTCACGACCTTCACCGGGTTCCCCTCCGCCCATCCTTTCCGCCCGTTCAACACCGCG
CGGAAGCCGCGGATCCACTCGACCCAGACCGCCAAGGTGGTCGGCAAGTCGGGCGAGGAGATCTGGCTCG
ACAAGTATGGGCGGATCAAGGTGCAGTTCCATTGGGACCGGCTCGGCACCAACGACGAGAAAAGCTCCTG
CTGGGTCCGGGTCGCGCAGGGCTGGGCCGGCAAGAACTACGGCATCATGTTCTTGCCGCGCGTCGGGCAG
GAAGTCGTGGTCACCTTCCTGGACGGCGACCCCGACCGGCCGCTGGTGACCGGTGCCGTCTACAACGCCG
AGCAGACCGTTCCCTATACTCTGCCCGACGATTCCACGAAGTGCACCATCAAGACGCAGACCTCGAAGAA
CGGCATGGGTAAGTTCAACGAGATCCGCTTCGAGGACAAGGCCGACAACGAGGAAATCTTCGTCCAGGCC
CAGAAGGACATGAATATCAAGGTCCTCCACGACCTGACTCGCTTGGTCAAGCATGACGAGGTCGAGACGA
TCGAAAACGACAGCGCCATCGATGTCAAGAACGACCGGACACTGACGGTCAGGAACAACCATTCGATCAC
CGTGTCCGAAGGCAACGAGACCCATGCGGTTTCGAGGGGCACCCGCGACCTGTCGGTCAAGGGCAAGGAG
ACGCACGTCAACGACGCCGACTTCGAGCACAGTGTCGACAAGAACTACGCGCTGACGGTCAAGGGCAACC
TGACCATCGACGTGACCGGCGACATCGTGATCAACGGCAAGTCGATCAAGCTGACGGCGACCTCGGCGGA
CATCGGCATCCAAGCGGCGACCGGCATCGGGATCAAGGCCGGCACGTCCCTCGACGTGAAGGCCGGCGCC
GCGACGACCGTGACGTCCGGCACGAACATGAAGATCGACGCCGGCATGGGCGCCACGCTCAAGGGCGGCA
CGACGCTGGACCTGAAAGCGGGGCTGGCTCTGACAGCCGAAGGCCTGTCCAGCACGGTCAAGGGGGCGGC
GTCGGCGGAAGTGAGCGGTGGCGGCATGCTGACGCTTAAAGGCGGCGTGGTGATGGTGAACTGA