SecReT6
Protein ID: 288960235
SecReT6 ID380
T6SS typei1
Gene symbol-
Locus tagAZL_a05000
StrainAzospirillum sp. B510
Repliconplasmid pAB510a [GenBank: NC_013855] [Browse all T6SS(s) in this replicon]
Location [Strand]618244..619881 [+]
ProductimpA domain protein
NoteTssA
UniProt IDD3P052
KEGG IDazl:AZL_a05000
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.50E-21, Aligned region: 45..105
ImpA-rel_N [PF06812], Evalue: 2.50E-21, Aligned region: 478..490
Protein Sequence: 545 a.a.     [Download]
>gi|288960235|ref|YP_003450575.1| impA domain protein [Azospirillum sp. B510]
MSDRASLGARPVSGPALPSARYEPEFDRLQSEVAKLDSGGPNAVDWREVVRHALTITETKSKDLLVGSYL
AYGLLRTESYAGLADGLMILAGMVEAFWDDLHPPKKREAARVNAVNWLGERLGPVVAEHPATPGNAAAVL
ASADALGRLNEALLSRLENSRPELGEAIRRLGARATEASALLAPPAVDLAPPAPSPPTSSTSGQTASVQP
ASSEAPPVPPASPPPLPAPAPVPAAVSAGATPAQIDRAIDQTAAGLRTLANAVRRADPSDPRAVELMRAA
VWLPVNGLPPAPAGTTPLRSPSAERIERCREWLGAGRFVDLFHDIEESLDTFPYWFEGQRLAALALEGAG
GKFTPSAHALRGALATLLRRLPGLGDLRYADGSPFLDDVTRGWVASDILAAPGGTAGGGVVDHPWAKALR
EARDAVAQGRAKEGVALFSASRPVERAGRGAFLGDLALARLCLEAGFTRAALDIAGKLEALAERRGLEDW
EPVLCADLCALVLECYRALPATAEGGRTRADRIAAVQARLGWLAMDRALDFIDVT
 
Nucleotide Sequence: 1638 bp     [Download]
>gi|288959735|ref|NC_013855.1|:618244-619881 Azospirillum sp. B510 plasmid pAB510a, complete sequence
ATGTCTGACCGCGCATCGCTTGGGGCCAGACCTGTTTCCGGCCCGGCGCTTCCCAGCGCCCGCTATGAGC
CGGAATTCGACAGGCTCCAGTCCGAGGTGGCCAAACTCGACAGCGGCGGACCGAACGCGGTCGACTGGAG
GGAGGTGGTGCGCCATGCGCTGACCATCACCGAAACCAAGTCGAAGGATCTGCTGGTCGGCTCCTATCTC
GCCTATGGCCTGCTGCGCACCGAATCCTATGCCGGTCTGGCCGACGGGCTGATGATCCTGGCGGGCATGG
TTGAGGCGTTCTGGGACGATCTCCATCCGCCGAAGAAGCGGGAGGCCGCGCGGGTCAACGCGGTGAACTG
GTTGGGGGAACGGCTCGGCCCCGTGGTGGCGGAGCATCCGGCCACCCCCGGCAACGCCGCCGCCGTGCTG
GCCAGCGCCGATGCGCTGGGCCGCCTGAACGAGGCGCTGCTCAGCCGTCTGGAGAACAGCCGGCCGGAGT
TGGGGGAGGCGATCCGCCGGCTTGGCGCACGGGCCACGGAGGCGTCGGCGCTGCTTGCCCCCCCGGCGGT
CGACCTTGCACCGCCGGCGCCTTCTCCCCCGACGTCTTCGACGTCCGGTCAGACCGCATCCGTCCAGCCT
GCCTCCAGCGAAGCGCCGCCGGTTCCGCCGGCATCGCCACCACCATTACCCGCACCCGCACCAGTGCCGG
CGGCGGTGTCGGCGGGGGCGACCCCGGCGCAGATCGACCGGGCGATCGACCAGACCGCCGCCGGCCTGCG
GACGCTCGCCAACGCCGTGCGTCGGGCCGATCCGTCCGATCCTCGCGCGGTCGAGCTGATGCGGGCCGCG
GTCTGGCTGCCTGTGAACGGTCTTCCCCCAGCACCGGCGGGAACGACGCCGCTGCGGTCACCCTCCGCCG
AGAGGATCGAGCGTTGCCGGGAGTGGTTGGGCGCCGGCCGGTTCGTCGACCTGTTCCACGACATCGAGGA
GAGCCTCGACACCTTTCCCTATTGGTTCGAAGGGCAGCGGCTGGCCGCTCTGGCGCTGGAGGGGGCGGGC
GGGAAATTCACGCCGTCGGCCCATGCGCTGCGCGGCGCTCTGGCCACTCTTCTGCGTCGTCTGCCCGGAC
TGGGCGACCTGCGCTATGCCGATGGGTCGCCGTTCCTCGACGATGTGACCCGCGGATGGGTGGCCTCCGA
CATTCTGGCGGCGCCAGGCGGGACGGCTGGGGGCGGGGTGGTCGATCATCCCTGGGCCAAGGCGCTGCGC
GAGGCACGGGATGCCGTGGCCCAGGGGCGCGCGAAGGAGGGGGTGGCCCTGTTCAGCGCCTCCCGTCCGG
TGGAGCGGGCCGGACGCGGCGCCTTCCTCGGGGATCTGGCGCTCGCCCGTCTGTGTCTTGAGGCCGGCTT
CACGCGGGCCGCGCTGGACATCGCCGGCAAGCTGGAGGCGCTGGCCGAACGGCGCGGGCTGGAGGATTGG
GAGCCGGTCCTCTGCGCCGATCTGTGCGCGCTGGTCCTTGAATGTTACCGCGCCCTGCCGGCGACGGCGG
AAGGCGGAAGGACCCGCGCCGACCGCATCGCGGCGGTACAGGCCCGGCTTGGCTGGCTGGCCATGGACCG
GGCCTTGGACTTCATCGACGTCACGTAA