SecReT6
Protein ID: 288960236
SecReT6 ID380
T6SS typei1
Gene symbol-
Locus tagAZL_a05010
StrainAzospirillum sp. B510
Repliconplasmid pAB510a [GenBank: NC_013855] [Browse all T6SS(s) in this replicon]
Location [Strand]619903..620409 [+]
Producthypothetical protein
NoteTssB
UniProt IDD3P053
KEGG IDazl:AZL_a05010
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.60E-52, Aligned region: 6..158
Protein Sequence: 168 a.a.     [Download]
>gi|288960236|ref|YP_003450576.1| hypothetical protein AZL_a05010 [Azospirillum sp. B510]
MALDSSVAPKERINIRFRPATGDTKQDVELPLKMLVIGDFTQRSDDTPIEERPLAGVNKDNFQDVMRSHQ
LALSTQVPNKLEEDAAEPLPVHLKFESVRDFEPERIVEQVPEMKALLELRSALLALKGPLGNVPAFRKTI
QATLEDSGARGRLLSELGLLPDGPGATG
 
Nucleotide Sequence: 507 bp     [Download]
>gi|288959735|ref|NC_013855.1|:619903-620409 Azospirillum sp. B510 plasmid pAB510a, complete sequence
ATGGCTCTCGATTCATCCGTCGCTCCGAAGGAGCGCATCAACATCCGGTTCCGCCCGGCGACCGGCGACA
CCAAGCAGGACGTGGAGTTGCCGCTGAAGATGCTGGTCATCGGCGACTTCACGCAACGGTCCGACGACAC
CCCGATCGAGGAGCGCCCGCTTGCCGGCGTCAACAAGGACAATTTCCAGGACGTGATGCGCAGCCATCAA
CTGGCGCTGTCGACCCAGGTGCCCAACAAGCTGGAGGAGGACGCGGCGGAGCCGCTTCCGGTTCATCTGA
AGTTCGAGTCCGTCCGTGACTTCGAGCCGGAGCGCATCGTCGAACAGGTGCCGGAAATGAAGGCCCTGCT
GGAACTGCGCAGCGCTCTGCTGGCGTTGAAGGGGCCGCTTGGCAATGTGCCGGCCTTCCGCAAGACCATC
CAGGCGACGCTGGAGGATAGCGGCGCGCGCGGCCGGCTTCTGTCCGAACTCGGCCTGCTGCCCGACGGAC
CCGGCGCGACCGGCTGA