SecReT6
Protein ID: 288960237
SecReT6 ID380
T6SS typei1
Gene symbol-
Locus tagAZL_a05020
StrainAzospirillum sp. B510
Repliconplasmid pAB510a [GenBank: NC_013855] [Browse all T6SS(s) in this replicon]
Location [Strand]620456..621940 [+]
Producthypothetical protein
NoteTssC
UniProt IDD3P054
KEGG IDazl:AZL_a05020
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 4.00E-184, Aligned region: 67..492
Protein Sequence: 494 a.a.     [Download]
>gi|288960237|ref|YP_003450577.1| hypothetical protein AZL_a05020 [Azospirillum sp. B510]
MATDTERQSTAAPTTTDEPSLLDQIMEQTRLRPVDEGYDLAKRGIEAFVSELMKPTRKDEKVNNAIVDQM
IAEIDAKLGRQIDTILHDDGFQKLETAWRGLKFLVDRTDFRENIKIEVLSATKDELREDFEDAPEIAKSG
LYKQVYVSEYGQFGGQPIGAVITNFEYSPNAADVKLMQNMAAVGAMSHTPVIGAAGPQFFGNDSYEALPN
LKDLQSIFDSPSYAKWNSFRESEDSRYFGLTLPRFLLRLPYGPQSTPIKSFNYQESASTDSKDYCWGNAA
FAFATRLSESFAKYRWCPNIIGPQSGGVVEDLPLHRFDAMGQTETKIPTEILISDRREYELAEQGFIALT
MRKGSDNAAFFSANSVQKPKSFGSSKEGKEAELNYKLGTQLPYLFIINRLAHYIKVLQRENIGSWKQRGE
LETELNNWIRDYVSDQDNPTAEVRSRRPLRRAKIVVEEVEGDVGWYRVNLKVQPHFKHMGADFTLNLTGK
LDKV
 
Nucleotide Sequence: 1485 bp     [Download]
>gi|288959735|ref|NC_013855.1|:620456-621940 Azospirillum sp. B510 plasmid pAB510a, complete sequence
ATGGCGACCGATACCGAACGACAATCCACGGCGGCCCCGACCACGACGGACGAACCGTCGCTGCTCGACC
AGATCATGGAACAGACCCGTCTGCGCCCGGTTGACGAGGGCTATGACCTTGCCAAGCGCGGCATCGAAGC
CTTCGTGTCGGAGCTGATGAAGCCGACCCGCAAGGACGAGAAGGTGAACAACGCCATCGTCGATCAGATG
ATCGCGGAGATCGACGCCAAGCTCGGCCGGCAGATCGACACGATCCTGCATGACGACGGTTTCCAGAAGC
TGGAAACGGCATGGCGCGGCCTGAAGTTTCTGGTCGACCGCACCGACTTCCGCGAGAACATCAAGATCGA
GGTGCTGTCCGCCACCAAGGACGAGCTTCGCGAGGATTTCGAGGACGCGCCCGAGATCGCCAAGTCCGGC
CTCTACAAGCAGGTCTATGTGTCGGAGTACGGCCAGTTCGGCGGCCAGCCGATCGGCGCGGTGATCACCA
ACTTCGAATACAGCCCCAACGCCGCGGACGTGAAGCTGATGCAGAACATGGCCGCTGTCGGCGCCATGTC
CCACACGCCGGTGATCGGTGCCGCCGGTCCGCAGTTCTTCGGCAATGACAGCTATGAGGCGCTGCCGAAT
CTGAAGGATCTCCAGTCGATCTTCGACAGCCCGAGCTACGCCAAGTGGAACTCCTTCCGGGAGTCCGAGG
ATTCCCGCTATTTCGGCCTGACCCTGCCGCGCTTCCTGCTGCGCCTGCCCTACGGCCCCCAGAGCACCCC
CATCAAATCCTTCAACTACCAGGAATCGGCGTCCACCGATTCCAAGGATTACTGCTGGGGCAACGCCGCC
TTCGCCTTCGCGACCCGCCTGTCGGAAAGCTTCGCCAAATACCGCTGGTGTCCGAATATCATCGGGCCGC
AGAGCGGTGGCGTGGTCGAGGATCTGCCGCTTCACCGCTTCGACGCGATGGGGCAGACCGAAACCAAGAT
TCCGACGGAGATCCTGATCTCCGACCGCCGCGAGTATGAATTGGCGGAACAGGGCTTCATCGCCCTGACC
ATGCGCAAGGGCAGCGACAACGCCGCCTTCTTCTCGGCCAACTCGGTGCAGAAGCCCAAGAGCTTCGGCA
GTTCCAAGGAAGGCAAGGAGGCTGAACTGAACTACAAGCTTGGCACCCAGCTTCCGTATCTCTTCATCAT
CAACCGGCTTGCCCACTACATCAAAGTGCTCCAGCGCGAGAACATCGGAAGCTGGAAGCAGCGCGGAGAG
CTGGAAACCGAGTTGAACAACTGGATCCGCGATTATGTCTCCGACCAGGACAATCCGACCGCCGAGGTCC
GCAGCCGCCGTCCGCTGCGCCGCGCCAAGATCGTGGTGGAGGAGGTCGAGGGGGATGTCGGCTGGTATCG
CGTCAACCTGAAGGTCCAGCCGCACTTCAAGCATATGGGGGCGGATTTCACCCTGAATCTGACCGGCAAG
CTCGACAAGGTCTGA