SecReT6
Protein ID: 288960238
SecReT6 ID380
T6SS typei1
Gene symbol-
Locus tagAZL_a05030
StrainAzospirillum sp. B510
Repliconplasmid pAB510a [GenBank: NC_013855] [Browse all T6SS(s) in this replicon]
Location [Strand]621996..622418 [+]
Producthypothetical protein
NoteTssE
UniProt IDD3P055
KEGG IDazl:AZL_a05030
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 5.40E-20, Aligned region: 29..121
Protein Sequence: 140 a.a.     [Download]
>gi|288960238|ref|YP_003450578.1| hypothetical protein AZL_a05030 [Azospirillum sp. B510]
MDPAMPLYARTLFERLEDGRTVPPVRMDPVQLSASILANLSAVFNARQGSCMTRPDYGLPDFNDALIKGP
ESMPVIARAIKAQIDRFEPRLVQVLVRPDHDPHNPLSLRFQISARLRGQDGERIGFETTLSDDGFVRVKR
 
Nucleotide Sequence: 423 bp     [Download]
>gi|288959735|ref|NC_013855.1|:621996-622418 Azospirillum sp. B510 plasmid pAB510a, complete sequence
ATGGACCCCGCCATGCCGCTTTACGCCAGAACCCTGTTCGAGCGCCTGGAGGACGGACGGACCGTGCCGC
CGGTGCGGATGGATCCCGTCCAGCTGTCCGCATCGATTCTGGCCAACCTCAGCGCCGTGTTCAACGCGCG
CCAGGGAAGCTGCATGACGCGCCCCGACTATGGTCTTCCCGACTTCAACGACGCGCTCATCAAGGGGCCG
GAATCGATGCCGGTGATCGCCCGTGCGATCAAGGCGCAGATCGACCGCTTCGAGCCGAGGCTGGTCCAGG
TTCTTGTCCGTCCAGACCATGATCCGCACAACCCCTTGAGTCTGCGTTTCCAGATTTCCGCCCGCCTCCG
GGGTCAGGACGGCGAACGGATCGGCTTCGAGACGACCTTGAGCGACGACGGTTTCGTCCGGGTCAAACGC
TGA