SecReT6
Protein ID: 288960239
SecReT6 ID380
T6SS typei1
Gene symbol-
Locus tagAZL_a05040
StrainAzospirillum sp. B510
Repliconplasmid pAB510a [GenBank: NC_013855] [Browse all T6SS(s) in this replicon]
Location [Strand]622429..624186 [+]
Producthypothetical protein
NoteTssF
UniProt IDD3P056
KEGG IDazl:AZL_a05040
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.00E-161, Aligned region: 3..581
Protein Sequence: 585 a.a.     [Download]
>gi|288960239|ref|YP_003450579.1| hypothetical protein AZL_a05040 [Azospirillum sp. B510]
MSFSRYYQDELAYLRDLGAEFAQENPTLAPFLARDASDPDVERLIEAFCFLTARIRQKLDDELPELSHSL
VSLLWPNLLRPFPAMTILELEPQAGAVSETQSLPPGCAFQSEPVDGTSCVFRNPHAGDIHPVRLAQASME
SMGDQSRLSAVLTPINGARLDTLRLDPLRFHLNFERDSGVGRQLLYRLTRRLRRVSVSLPDGRTLHLPAS
ALRPVGFTRGEQLLPQSPQSFHGHILLQEYLLFPEKFLFFDLVGLAQAGPQPRGDWTIRFELDGPADETA
RLVTANLRINCVPVVNLFPLEATPLDISQAKTEYRLLPAAARPQHYGIFSIDHVTGWVRDRGERVDYSAF
ESFLHAIDDGRRSSTYYHVRRKPAVARDGIDTFLALVDETRHAVERRPEIVSVAMTCSNATLAEMVPVGG
VNRATATSPTYARFRNISPVSPQALPPLDVQLLWRLIANLAVSAGSLTDIAALRTLIGSLDFVALQDQRA
RRRLELRLEALRGIEAKPSDLRMPAGYLLRGTEISLIVDEARLGGSGEAFLLGSVLNAFFGEASNINSFH
KLRLCGGDSNWRCDWPVRVGGGAAP
 
Nucleotide Sequence: 1758 bp     [Download]
>gi|288959735|ref|NC_013855.1|:622429-624186 Azospirillum sp. B510 plasmid pAB510a, complete sequence
ATGAGCTTTTCCCGCTATTATCAGGATGAACTGGCCTACCTGCGTGATCTCGGTGCGGAGTTCGCGCAGG
AGAATCCGACCCTGGCCCCCTTCCTGGCGCGGGACGCCAGCGATCCCGACGTCGAGCGGCTGATCGAGGC
GTTTTGTTTCCTGACCGCCCGCATCCGCCAGAAGCTGGACGATGAACTGCCGGAACTTTCGCATTCGCTG
GTGTCGCTGCTCTGGCCGAACCTGCTGCGGCCCTTCCCGGCGATGACCATCCTCGAGCTGGAACCTCAGG
CCGGTGCGGTCAGCGAGACGCAAAGCCTTCCTCCAGGATGCGCCTTCCAGTCCGAGCCGGTCGATGGAAC
ATCTTGCGTCTTCCGCAATCCGCATGCGGGCGACATCCATCCGGTCCGTCTTGCCCAGGCATCGATGGAA
TCGATGGGGGACCAGAGCCGGCTCAGCGCCGTGCTGACCCCGATCAATGGGGCACGCCTGGACACGCTGC
GCCTCGATCCCCTGCGCTTCCATCTGAATTTCGAGCGGGACAGCGGTGTCGGCCGCCAACTGCTCTACCG
GTTGACCCGCCGGCTGCGCCGTGTGTCGGTGTCGCTGCCGGACGGCCGCACCCTTCACTTGCCCGCCTCC
GCCCTCCGTCCGGTCGGCTTCACCAGGGGGGAGCAGCTGCTGCCGCAGTCGCCGCAGAGTTTCCACGGGC
ATATCCTGCTTCAGGAATATCTGCTGTTCCCGGAAAAATTCCTGTTCTTCGATCTGGTCGGGCTGGCCCA
AGCCGGACCGCAGCCGCGCGGCGACTGGACCATCAGGTTCGAACTCGACGGTCCGGCGGACGAAACGGCG
AGGCTGGTCACGGCCAATCTGCGCATCAACTGCGTGCCGGTCGTCAACCTGTTTCCCCTGGAGGCCACGC
CGCTGGACATCTCGCAGGCCAAGACCGAATACCGGCTGCTGCCGGCGGCCGCGCGACCGCAGCATTACGG
CATCTTCTCCATCGACCATGTCACCGGCTGGGTCCGCGACCGTGGTGAGCGGGTGGATTATTCGGCCTTC
GAATCCTTCCTGCATGCCATTGACGATGGCCGGCGTTCCTCGACCTATTACCATGTCCGGCGCAAGCCGG
CGGTGGCGCGGGATGGCATCGACACCTTTCTCGCCCTGGTCGACGAGACCCGGCACGCGGTGGAGCGCCG
GCCGGAAATCGTCTCCGTCGCCATGACCTGCAGCAACGCGACGCTGGCCGAGATGGTGCCGGTGGGGGGC
GTCAATCGGGCTACCGCCACCTCTCCCACCTATGCCCGTTTCCGCAATATCTCGCCGGTCAGCCCGCAGG
CGCTTCCGCCGCTCGACGTCCAACTGCTGTGGCGATTGATCGCCAATCTGGCGGTGAGCGCGGGCAGCCT
GACCGATATCGCCGCCCTGCGCACGCTGATTGGGAGCCTGGATTTCGTCGCCCTCCAGGACCAGAGGGCG
CGGCGGCGCCTCGAACTGCGGCTGGAGGCGTTGCGCGGCATCGAGGCGAAGCCCTCGGATTTGAGGATGC
CCGCCGGCTATCTTCTGCGTGGCACCGAGATCTCGCTGATCGTTGACGAGGCCAGGCTGGGCGGTTCGGG
GGAGGCTTTTCTGCTGGGCTCGGTGCTGAACGCCTTTTTCGGCGAGGCGTCCAACATCAACAGCTTCCAC
AAGCTCCGCCTGTGCGGCGGCGACAGCAACTGGCGATGCGACTGGCCGGTCCGGGTCGGCGGCGGGGCCG
CGCCGTGA