SecReT6
Protein ID: 288960240
SecReT6 ID380
T6SS typei1
Gene symbol-
Locus tagAZL_a05050
StrainAzospirillum sp. B510
Repliconplasmid pAB510a [GenBank: NC_013855] [Browse all T6SS(s) in this replicon]
Location [Strand]624120..625223 [+]
Producthypothetical protein
NoteTssG
UniProt IDD3P057
KEGG IDazl:AZL_a05050
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 5.70E-83, Aligned region: 27..340
Protein Sequence: 367 a.a.     [Download]
>gi|288960240|ref|YP_003450580.1| hypothetical protein AZL_a05050 [Azospirillum sp. B510]
MRRRQQLAMRLAGPGRRRGRAVSSPPPQGWSFFQLVMQLQRASDPRSAPVGELGPAASEAIRFRGTPSLG
FPASDISGLDLVDVARKPDDGTQAFAPDRRATLACAFLGLYGSSSPLPAGYTERILWAAADDTRLRDFLD
LFNHRLLSLMFRSWQKYRAYAGGQHDGAAVLAARLFALGGIGNAQAQLAPRIDPGRLLRYVGLLRLRNRS
ANIIGQVLSGYFDGLPMVVEELVQRTVVLPDWQRNGLGTGLCCLGRDFIIGDRMEDGAGKIRVHVGPLDR
EAFPRFLPDGDAHKALCALIHLLLPLPCEVDIMLSLAEAAVPPFRLEVGEIRLGWSSWVGDGTRGERTVT
FALGPRGAAPDGTRGPW
 
Nucleotide Sequence: 1104 bp     [Download]
>gi|288959735|ref|NC_013855.1|:624120-625223 Azospirillum sp. B510 plasmid pAB510a, complete sequence
GTGCGGCGGCGACAGCAACTGGCGATGCGACTGGCCGGTCCGGGTCGGCGGCGGGGCCGCGCCGTGAGCT
CCCCTCCTCCGCAGGGCTGGTCCTTCTTCCAGCTGGTGATGCAGCTTCAACGGGCGTCCGATCCGCGCTC
CGCCCCGGTCGGAGAACTGGGGCCGGCGGCATCCGAGGCGATCCGTTTCCGTGGAACGCCCAGCCTCGGC
TTTCCCGCTTCGGACATCAGCGGGCTGGATTTGGTGGATGTCGCGCGGAAACCCGATGACGGGACGCAGG
CCTTCGCTCCCGACCGCCGGGCGACGCTGGCCTGCGCCTTTCTCGGCCTCTACGGCTCATCATCCCCCTT
GCCGGCGGGTTATACCGAGCGGATCCTGTGGGCTGCCGCCGATGACACGCGGCTGCGCGACTTCCTGGAT
CTGTTCAACCACCGGCTCCTGTCGCTGATGTTCCGTAGTTGGCAGAAGTATCGGGCCTATGCCGGCGGCC
AGCATGACGGGGCCGCGGTTCTGGCCGCGAGGCTGTTTGCCCTGGGGGGGATCGGCAATGCCCAGGCGCA
GCTCGCGCCGCGCATCGATCCCGGCCGTCTGCTGCGTTATGTCGGCCTGCTGCGTCTGCGCAACCGTTCG
GCCAACATCATCGGGCAGGTGTTGAGCGGCTATTTCGACGGCTTGCCGATGGTGGTGGAGGAACTGGTCC
AGCGTACCGTCGTCCTGCCCGATTGGCAGCGCAACGGGCTGGGCACCGGTCTGTGCTGTCTTGGACGCGA
CTTCATCATCGGAGACCGGATGGAGGATGGCGCCGGAAAGATCCGTGTTCATGTCGGGCCTCTCGATCGG
GAGGCGTTTCCCCGCTTCCTGCCCGACGGCGATGCGCACAAGGCGCTTTGCGCCTTGATCCATCTCCTCC
TGCCGCTGCCCTGCGAGGTCGATATCATGCTGTCCCTGGCGGAGGCGGCGGTGCCGCCCTTCCGCCTGGA
GGTGGGCGAAATCCGGCTCGGCTGGTCGAGTTGGGTCGGGGACGGGACCAGGGGCGAGCGGACGGTGACC
TTTGCGCTCGGTCCACGCGGCGCCGCTCCCGACGGAACCCGGGGCCCGTGGTAG