SecReT6
Protein ID: 288960242
SecReT6 ID380
T6SS typei1
Gene symbol-
Locus tagAZL_a05070
StrainAzospirillum sp. B510
Repliconplasmid pAB510a [GenBank: NC_013855] [Browse all T6SS(s) in this replicon]
Location [Strand]625691..626209 [-]
Producthypothetical protein
NoteTssD
UniProt IDD3P059
KEGG IDazl:AZL_a05070
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.20E-30, Aligned region: 18..156
Protein Sequence: 172 a.a.     [Download]
>gi|288960242|ref|YP_003450582.1| hypothetical protein AZL_a05070 [Azospirillum sp. B510]
MATGAYMKVIGKNQGAISDRAFSAESVGSTIFQEAHQDCIYVLASSMEVAVPTDPQSGQPTGVRGHKPFT
ITKYFDRASPLLWQAACTGEVLEISLSFYRTSARGGLEQYYSIKFTDAVIVDMKGYFQNILMDEFKGLGH
HEDVSFVYRAVEWTHEMAGTTGSDDWRRPTYS
 
Nucleotide Sequence: 519 bp     [Download]
>gi|288959735|ref|NC_013855.1|:c626209-625691 Azospirillum sp. B510 plasmid pAB510a, complete sequence
ATGGCGACCGGTGCCTATATGAAAGTGATCGGCAAGAACCAGGGCGCGATCAGCGACCGTGCCTTTTCGG
CCGAGAGCGTCGGCAGCACGATCTTTCAGGAAGCGCATCAGGATTGTATTTACGTCCTGGCCTCCAGCAT
GGAAGTCGCCGTGCCGACCGATCCGCAATCCGGCCAGCCGACCGGCGTGCGTGGTCACAAGCCCTTCACC
ATCACCAAATATTTCGACCGCGCCTCGCCGCTGCTCTGGCAGGCCGCCTGCACCGGCGAGGTGCTGGAAA
TCTCGCTCAGCTTCTACCGAACCTCCGCGCGCGGCGGGCTGGAGCAGTATTACAGCATCAAGTTCACCGA
CGCCGTGATCGTGGACATGAAGGGCTATTTCCAGAATATCCTGATGGACGAGTTCAAGGGCCTCGGCCAT
CACGAGGATGTGTCCTTCGTCTACCGCGCGGTGGAATGGACGCATGAGATGGCCGGAACCACGGGCTCCG
ACGACTGGCGGCGGCCGACCTACAGCTGA