SecReT6
Protein ID: 288960246
SecReT6 ID380
T6SS typei1
Gene symbol-
Locus tagAZL_a05110
StrainAzospirillum sp. B510
Repliconplasmid pAB510a [GenBank: NC_013855] [Browse all T6SS(s) in this replicon]
Location [Strand]631731..632711 [-]
Producthypothetical protein
NoteTssL
UniProt IDD3P063
KEGG IDazl:AZL_a05110
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.90E-55, Aligned region: 76..274
Protein Sequence: 326 a.a.     [Download]
>gi|288960246|ref|YP_003450586.1| hypothetical protein AZL_a05110 [Azospirillum sp. B510]
MSQFIDEDDAPTTPRPIQVPPPPRPAVPGRPQPPTPASPRIAAPQRPAAPQALLQRRPPAADPTAMPARG
RDGGTNALLTAAGPLLTMVTQVAFSSEHADADALQRGFLAAFTRFETEAAAAGYREDTVTTAKYVLAALV
DEMVLDTGWGFESVWGSRSLLSLLFRETWGGEKVFTILDRLKAEPDRNIDALELIGRCLAFGFQGKYRRL
DGGLYQLEDLRSELDRLCRSLRPAVDPRLASTVAPVKAATRLRRFLPGWVVFVLVAVLLAGAFLSAKGKL
NQRAEAALASLARVAGAGTAAGAAAVPARAPAFLPAAPNPSPLTAR
 
Nucleotide Sequence: 981 bp     [Download]
>gi|288959735|ref|NC_013855.1|:c632711-631731 Azospirillum sp. B510 plasmid pAB510a, complete sequence
ATGAGCCAGTTCATCGACGAGGACGACGCCCCGACCACACCGCGGCCGATCCAGGTTCCACCGCCGCCGC
GTCCGGCGGTGCCGGGCCGACCGCAGCCCCCAACGCCGGCATCGCCACGCATCGCCGCGCCACAGCGTCC
GGCCGCCCCCCAGGCGCTCCTCCAACGGCGGCCTCCGGCGGCCGACCCGACGGCGATGCCCGCGCGCGGC
CGTGACGGCGGCACCAACGCGTTGCTGACGGCGGCCGGACCGCTGCTGACGATGGTCACGCAAGTCGCCT
TTTCCAGCGAGCATGCCGACGCCGACGCCTTGCAGCGCGGATTCCTGGCCGCCTTCACCCGCTTCGAAAC
CGAAGCCGCCGCCGCCGGATATCGCGAAGACACCGTGACCACGGCGAAATACGTGCTGGCCGCCCTGGTG
GACGAGATGGTGCTCGATACCGGATGGGGTTTCGAAAGCGTGTGGGGAAGCCGCAGCCTGCTGTCCCTCC
TGTTCAGGGAGACCTGGGGGGGTGAGAAGGTGTTCACCATCCTCGACCGGCTGAAGGCCGAACCGGACCG
CAACATCGACGCGCTGGAACTGATCGGCCGCTGCCTGGCGTTCGGTTTCCAGGGCAAATACCGGCGGCTG
GACGGTGGCCTCTACCAGCTCGAGGATCTGCGAAGCGAGCTTGACCGCTTGTGCCGCAGCCTGCGTCCCG
CCGTCGACCCGCGGCTCGCCTCCACCGTGGCTCCGGTGAAAGCCGCGACCCGGCTGCGCCGGTTCCTGCC
GGGCTGGGTGGTGTTCGTCCTGGTCGCGGTGCTGCTCGCCGGCGCCTTCCTGTCCGCGAAGGGCAAGCTG
AACCAGAGGGCCGAAGCCGCCCTCGCCAGCCTCGCCCGCGTGGCCGGCGCCGGAACCGCCGCCGGAGCCG
CCGCCGTGCCCGCCCGCGCACCGGCCTTCCTTCCGGCCGCCCCGAATCCCAGCCCGCTGACCGCCCGATG
A