SecReT6
Protein ID: 288960247
SecReT6 ID380
T6SS typei1
Gene symbol-
Locus tagAZL_a05120
StrainAzospirillum sp. B510
Repliconplasmid pAB510a [GenBank: NC_013855] [Browse all T6SS(s) in this replicon]
Location [Strand]632708..634039 [-]
Producthypothetical protein
NoteTssK
UniProt IDD3P064
KEGG IDazl:AZL_a05120
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 8.80E-139, Aligned region: 18..439
Protein Sequence: 443 a.a.     [Download]
>gi|288960247|ref|YP_003450587.1| hypothetical protein AZL_a05120 [Azospirillum sp. B510]
MWTSKPIWLEAMFIRPQHFQQADRHTAWHIDSRVRAAAPHAWGWAALAIDRTLLRQGQFALTDGRGILPD
GTPFDLSPAGALPPAREVPGDLAERLVHLALPAPQRGQSEVALDNRAGRYRATEVEVDDTASPNGVTAAI
KVGAPAFRLVFEGESMDGLIGLGCARVERVRESREVVLSAQYIPPTLAVDVDRRLTEMLGEVVSLLQSRG
NALAERLNPDNWQSNAGFLDFALLQTVNRHEPLLAGMAGADGLHPLDLHRALLELAGDLATFKTGRHRPP
PFPRYRHQDLESSFTPLMAEIRSALTMVTDQPVVAIPLEARRFGIHIGQPADRTLFRDAQFVLAVNAAVP
PDTIRNLFPSHVKVGPVEDIRSLVNLQLPGIGLTPLAVAPRQLPFHRGFTYFELDRNAASWPKLLSSAAI
ALHVSGDFPALEMEFWAIRNAAS
 
Nucleotide Sequence: 1332 bp     [Download]
>gi|288959735|ref|NC_013855.1|:c634039-632708 Azospirillum sp. B510 plasmid pAB510a, complete sequence
ATGTGGACCAGCAAGCCGATCTGGCTCGAAGCGATGTTCATCCGGCCTCAACATTTCCAGCAGGCCGACC
GCCACACCGCATGGCACATCGACAGCCGGGTGCGAGCCGCCGCCCCGCATGCCTGGGGCTGGGCCGCGCT
GGCGATCGACCGGACCCTGCTGCGCCAGGGGCAGTTCGCGCTGACCGACGGACGCGGCATCCTGCCCGAC
GGCACCCCCTTCGACCTCTCGCCGGCCGGCGCCCTGCCTCCGGCGCGGGAGGTTCCGGGCGATCTCGCCG
AGCGGCTGGTCCATCTGGCCCTGCCGGCTCCCCAACGCGGGCAATCGGAGGTCGCGCTGGACAACCGCGC
CGGCCGTTACCGTGCCACGGAGGTCGAGGTGGACGATACCGCCAGCCCCAACGGCGTCACCGCCGCGATC
AAGGTCGGCGCCCCCGCTTTCCGCCTGGTCTTCGAAGGCGAGAGCATGGACGGGCTGATCGGCCTCGGTT
GCGCCCGCGTTGAAAGGGTCCGCGAAAGCCGGGAGGTGGTTCTGTCGGCCCAATACATACCGCCGACCCT
CGCCGTCGATGTCGACCGCCGGCTGACCGAGATGCTCGGGGAGGTGGTATCCCTGCTGCAAAGCCGGGGA
AACGCGCTGGCGGAGCGGTTGAATCCCGACAACTGGCAAAGCAATGCCGGCTTTCTCGATTTCGCCCTGC
TGCAAACGGTGAACCGCCACGAGCCGTTGCTGGCGGGCATGGCCGGGGCGGATGGGCTGCACCCGCTCGA
TCTGCACCGGGCCCTCCTCGAACTGGCCGGCGACCTCGCCACCTTCAAAACGGGGCGGCACCGGCCGCCG
CCCTTTCCACGCTACCGCCACCAGGATCTGGAAAGCAGTTTCACGCCGCTGATGGCGGAGATCCGCAGCG
CCCTGACCATGGTCACCGATCAGCCGGTGGTGGCCATTCCCTTGGAGGCCAGGCGTTTCGGCATTCACAT
CGGGCAGCCCGCCGACCGGACCCTGTTCCGCGACGCGCAGTTCGTGCTGGCGGTGAACGCCGCGGTGCCG
CCCGACACCATCCGGAACCTGTTTCCCTCGCACGTCAAGGTCGGCCCGGTGGAAGACATCCGAAGTCTGG
TGAATCTCCAGCTGCCCGGCATCGGCCTGACGCCGCTGGCGGTCGCTCCGCGCCAGTTGCCCTTCCATCG
CGGCTTCACCTATTTCGAGCTGGACCGCAACGCCGCCTCCTGGCCCAAGCTCCTCAGTTCCGCCGCCATC
GCACTGCATGTCAGCGGTGACTTCCCGGCTCTCGAGATGGAGTTCTGGGCCATTCGGAACGCCGCGTCAT
GA