SecReT6
Protein ID: 288960248
SecReT6 ID380
T6SS typei1
Gene symbol-
Locus tagAZL_a05130
StrainAzospirillum sp. B510
Repliconplasmid pAB510a [GenBank: NC_013855] [Browse all T6SS(s) in this replicon]
Location [Strand]634097..634624 [-]
Producthypothetical protein
NoteTssJ
UniProt IDD3P065
KEGG IDazl:AZL_a05130
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 5.40E-34, Aligned region: 19..141
Protein Sequence: 175 a.a.     [Download]
>gi|288960248|ref|YP_003450588.1| hypothetical protein AZL_a05130 [Azospirillum sp. B510]
MTLMASITPSRSALLLFLLMTAACGSTKPPPPTRITATIAASDQINPNALGQPSPLVVRVYELKNLDQFI
AADFFTLYDSDQLALAQSLVARRELSVKPGETVKVEGGASGSEATKFVGVFAAYREGQAATWRASVPIVA
SAVNLPLFKLDVNSVSLKEDPPPMPETGGTWWWPF
 
Nucleotide Sequence: 528 bp     [Download]
>gi|288959735|ref|NC_013855.1|:c634624-634097 Azospirillum sp. B510 plasmid pAB510a, complete sequence
GTGACCCTCATGGCCTCCATCACACCTTCGAGATCGGCGCTGCTCCTGTTCCTGCTGATGACGGCGGCCT
GCGGCTCGACCAAACCGCCGCCGCCAACCCGGATCACCGCGACCATCGCCGCATCGGACCAGATCAATCC
CAACGCGCTCGGGCAACCATCGCCACTGGTCGTGCGCGTGTACGAGTTGAAGAACCTCGACCAGTTCATC
GCCGCCGACTTCTTCACGCTCTACGACAGCGACCAGCTGGCGCTGGCACAGTCGCTGGTGGCAAGGCGGG
AGCTGTCGGTCAAACCGGGAGAGACGGTCAAGGTCGAAGGCGGGGCCAGCGGCAGCGAGGCCACGAAGTT
CGTCGGCGTTTTCGCAGCCTATCGCGAAGGGCAGGCCGCCACCTGGCGGGCCAGCGTCCCGATCGTGGCC
AGTGCGGTCAACCTGCCGCTGTTCAAGCTCGACGTCAATTCGGTGAGCCTGAAGGAAGACCCGCCTCCGA
TGCCTGAAACCGGTGGGACCTGGTGGTGGCCGTTCTGA