SecReT6
Protein ID: 288960249
SecReT6 ID380
T6SS typei1
Gene symbol-
Locus tagAZL_a05140
StrainAzospirillum sp. B510
Repliconplasmid pAB510a [GenBank: NC_013855] [Browse all T6SS(s) in this replicon]
Location [Strand]634621..635637 [-]
ProductFHA domain-containing protein
NoteFha
UniProt IDD3P066
KEGG IDazl:AZL_a05140
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 6.20E-16, Aligned region: 27..94
Protein Sequence: 338 a.a.     [Download]
>gi|288960249|ref|YP_003450589.1| FHA domain-containing protein [Azospirillum sp. B510]
MRLLLMLDGRPPQGLAGEAVFGMAGGTIGRASSCDWVLRDPARLISARHAVVTFENGRFFLVDTSSNGIL
YNNVRPVGRSNRVQLSSGDRLAIGPFRILARLEDDGTAELPETALAAWSPTAADPGLGDAPGPGSIQRID
PLEALSPPSDDPAPATGGAIPDDFDPLADILRAETPLPRRQAVLQPLAVPPARPGNTVPAPPNPHPLPQA
VTPAAPSPADGLAGAERLIPSPDGIGFGGRAILPEARRAAPVTVLDAVQASALAGFWRGLNVGPPPDARQ
AAMAEALGMALAAVLDHGAGGDWRLALRDGDPVALRRIVGPRERTDSSTPTILPTGRT
 
Nucleotide Sequence: 1017 bp     [Download]
>gi|288959735|ref|NC_013855.1|:c635637-634621 Azospirillum sp. B510 plasmid pAB510a, complete sequence
ATGCGGCTGCTACTGATGCTCGACGGGCGCCCGCCCCAGGGACTTGCCGGAGAGGCCGTGTTCGGTATGG
CCGGCGGCACCATCGGACGGGCCAGCTCGTGCGACTGGGTGCTGCGGGATCCGGCGCGCCTGATCTCCGC
CCGGCATGCCGTGGTGACGTTCGAGAATGGACGCTTCTTCCTGGTGGATACCAGTTCCAACGGCATCCTT
TACAACAATGTGCGGCCGGTCGGTCGCAGCAACCGGGTTCAGCTGTCCTCCGGCGACCGGCTGGCCATCG
GCCCCTTCCGGATCCTCGCCCGGTTGGAGGATGACGGAACGGCCGAGCTGCCCGAAACGGCACTGGCAGC
CTGGAGCCCCACCGCGGCCGATCCCGGCCTGGGGGATGCTCCCGGTCCGGGAAGCATCCAGAGGATCGAT
CCGCTGGAAGCGCTGTCACCCCCATCCGACGATCCGGCCCCGGCAACCGGCGGCGCCATTCCGGACGATT
TCGACCCGCTGGCCGACATCCTGAGGGCCGAAACGCCGCTGCCCCGACGGCAGGCCGTGCTCCAGCCCCT
CGCCGTTCCCCCGGCCCGGCCTGGGAACACGGTCCCGGCCCCGCCGAATCCCCACCCCCTCCCGCAGGCG
GTCACGCCGGCCGCCCCATCGCCGGCAGACGGCCTTGCCGGTGCCGAACGCCTCATCCCGTCCCCCGACG
GGATCGGCTTTGGCGGACGGGCGATCCTCCCGGAAGCCCGGCGGGCGGCCCCCGTCACCGTCCTGGACGC
CGTCCAGGCATCGGCCCTTGCCGGCTTCTGGCGCGGGTTGAATGTCGGACCTCCGCCCGACGCCCGCCAA
GCGGCGATGGCGGAGGCGCTGGGAATGGCACTGGCCGCCGTGCTCGACCACGGAGCGGGCGGCGACTGGC
GGCTGGCGCTGCGCGATGGAGACCCGGTGGCGCTGCGGCGGATCGTCGGCCCGCGGGAGCGGACCGATTC
TTCAACTCCCACCATTCTGCCCACGGGACGGACGTGA