SecReT6
Protein ID: 288960250
SecReT6 ID380
T6SS typei1
Gene symbol-
Locus tagAZL_a05150
StrainAzospirillum sp. B510
Repliconplasmid pAB510a [GenBank: NC_013855] [Browse all T6SS(s) in this replicon]
Location [Strand]635883..639890 [+]
Producthypothetical protein
NoteTssI
UniProt IDD3P067
KEGG IDazl:AZL_a05150
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.50E-40, Aligned region: 22..326
Phage_GPD [PF05954], Evalue: 5.50E-40, Aligned region: 595..638
Phage_GPD [PF05954], Evalue: 5.50E-40, Aligned region: 865..905
Phage_GPD [PF05954], Evalue: 5.50E-40, Aligned region: 946..1040
Phage_base_V [PF04717], Evalue: 3.30E-14, Aligned region: 392..463
Phage_base_V [PF04717], Evalue: 3.30E-14, Aligned region: 953..965
T6SS_Vgr [PF13296], Evalue: 0.0021, Aligned region: 471..507
T6SS_Vgr [PF13296], Evalue: 0.0021, Aligned region: 597..624
T6SS_Vgr [PF13296], Evalue: 0.0021, Aligned region: 1085..1104
Protein Sequence: 1335 a.a.     [Download]
>gi|288960250|ref|YP_003450590.1| hypothetical protein AZL_a05150 [Azospirillum sp. B510]
MFAEGILDDPAIEVTRFTEVSGLSRLTDLMLTLATPNLGSINADLLLGRAIEIVVETPHAEELNIVMRQG
AAPAGGAVPGRRTLYGIVTEITDAARASGASMIYELRVQPRVAKLAHQSGMHLHADSSVPDTLAAVLTRA
GFQRDLDFVFRLTGNYPKRSFALQFNESDLDFLTRLAEHWGIGFFFEHAEGRDILVFTDGDPLWKRGAVP
VLPFNGAGEKLGITEIRSRRTRLPSRYVLRDYNADTPDADWSRAITLDGGDGTQIVEYAANFESLDEAAL
LLKARSDALTAAERLFTGVCAEAVIDAGTLIQIDGHPGMDGLWLAVTLVECDYTRPLGGGQGEDRMIVRF
TAALSGRNVRPERRTPKPRMDGLLAGVIEPESDPTYAKLDEQGRYKVRLLIDDPAENPAPFARVRMAQPH
GGQGYGVHLPLRPGTEVVLAFLNGDPDRPVIAGVVPNARLVSPIDQSNNTSNVIRTGGGNQIAFEDEADG
ERIRLSTPHKDSSIRMGAPDYPDSGIVMQTKASLHAYPAYGMNVVAPFAAVSGDYVHLSGRKNSVLAGAS
PFSSAARGAKPDLHVLGVEGMAADVTQGLNEFQTIQSDQQAKTDKAREALEEARLAFEAARDAAATVTGT
REEEAAGLTSEELALFDDPGSPVTYPLYTEALVALQTAIDSADVTTGTAVDAAKAAAAGLDGQAQAQGII
QRQTAMLAQLESEGASRMAVMDDYRRVKGADATVFLAEREAAYAYAEAAAGVMEALADQAAIDHETLRAA
HREALDARRMPSNLPDGVFPPDVIETYRQAGQRLLRAAIDLVPDTVVPKSAEIAAAKTAYGAAGEALLAA
VPPRRVGATGSLAAEINAAEMFVDAKLSWAEAGARAARARTDADSTRRTFEQARGKRRTDAPVTRFPPSL
QGSYDTFVEASDTVLSSSDSSDARDSMLVSQALAAMDTLAPVFPSGDNALPFIIAAEVMHYSGVLSTAFQ
YERARLKLQRMELDRRATADALQALDRFQAGTADPSASTSDMMRALQEAAIALERLRDLSRNAAWAAAAE
GVETLAQHSGATRSSLSGEAGGSVFTRGGKTSFLELGSDNSVHLRAGERILQSAGMIAITANGDEGTGKD
RRKRRMDERRDERRDECRDERRAGMRNGTGRSGKDDDTVPITEAVGQGPDSAPPAAAAGTVLVSGGARVV
LSSQGQVEAAAPTVTIGSDSLNAVATKSVSLGCAADTDAAKTAGIEITPNSITFTVGDTTISMTESGITL
SADSIALNGDGAVSLASGGVIVLTSLSTQIIAALDVSTMATNISSMGVICETLAVSVDTMAAVNASTLAP
FVTIN
 
Nucleotide Sequence: 4008 bp     [Download]
>gi|288959735|ref|NC_013855.1|:635883-639890 Azospirillum sp. B510 plasmid pAB510a, complete sequence
GTGTTCGCCGAGGGGATCCTCGACGATCCGGCGATCGAGGTGACGCGTTTCACCGAGGTCAGCGGGCTGT
CGCGTCTGACCGATCTGATGCTGACCCTGGCCACGCCCAATCTCGGCTCGATCAACGCCGATCTTCTGCT
GGGCCGCGCGATCGAGATCGTGGTGGAGACCCCCCACGCCGAGGAGCTGAACATCGTGATGCGGCAGGGC
GCGGCCCCGGCCGGCGGCGCGGTGCCGGGCCGCCGCACGCTGTACGGCATCGTGACGGAGATCACCGACG
CCGCCCGCGCCAGCGGCGCGTCGATGATCTACGAGCTGCGCGTCCAGCCGCGCGTCGCCAAGCTGGCCCA
TCAGTCCGGCATGCATCTGCACGCCGATTCCAGCGTTCCCGACACACTCGCGGCCGTGCTGACGCGGGCC
GGATTCCAGCGCGATCTCGATTTCGTCTTCCGGCTGACCGGTAATTACCCCAAGCGCAGCTTCGCTTTGC
AGTTCAACGAGAGCGACCTCGATTTCCTGACCAGGCTGGCCGAGCATTGGGGAATCGGATTCTTCTTCGA
GCATGCCGAAGGGCGCGACATTCTGGTCTTCACCGATGGCGATCCTCTGTGGAAGCGCGGCGCCGTGCCG
GTGCTGCCCTTCAACGGCGCCGGGGAGAAGCTCGGCATCACGGAGATCCGCTCGCGCCGCACCCGGTTGC
CGAGCCGTTATGTGCTGCGCGACTATAACGCCGACACGCCGGACGCCGACTGGTCGCGCGCCATCACGCT
GGACGGGGGCGACGGCACCCAGATCGTGGAATATGCGGCCAATTTCGAGAGCCTCGACGAGGCCGCCCTG
CTGCTGAAGGCCCGTTCCGACGCGCTGACGGCGGCGGAGCGGCTGTTCACCGGTGTGTGCGCCGAGGCGG
TGATCGACGCGGGCACCCTGATCCAGATCGACGGACATCCCGGCATGGATGGTCTGTGGCTGGCGGTCAC
CTTGGTGGAGTGCGATTACACCCGGCCGCTCGGCGGCGGCCAGGGCGAGGACCGCATGATCGTGCGCTTC
ACCGCCGCCCTGTCCGGCCGCAATGTCCGGCCGGAACGCCGCACGCCCAAGCCCCGGATGGACGGGTTGC
TCGCCGGCGTCATCGAACCGGAAAGCGACCCGACCTATGCCAAGCTGGATGAACAGGGCCGTTACAAGGT
CCGGCTTCTGATCGACGATCCGGCGGAGAACCCGGCGCCCTTCGCCCGCGTGCGCATGGCCCAGCCGCAT
GGTGGCCAGGGCTATGGCGTGCATTTGCCGTTGCGGCCCGGAACCGAGGTGGTCCTGGCCTTTCTCAACG
GCGACCCTGACCGGCCGGTGATCGCGGGGGTGGTGCCGAACGCCCGGCTGGTCAGTCCGATCGACCAGAG
CAACAACACCAGCAATGTCATCCGCACCGGTGGCGGCAACCAGATCGCCTTCGAGGACGAGGCGGACGGC
GAACGGATCCGTCTGTCGACGCCGCACAAGGACAGCTCGATCCGCATGGGGGCGCCCGACTATCCCGATT
CCGGCATCGTGATGCAGACCAAGGCCAGCCTGCATGCCTATCCGGCCTATGGCATGAACGTGGTGGCGCC
CTTCGCGGCGGTGTCCGGCGACTATGTCCATCTGTCGGGCCGCAAGAATTCCGTGTTGGCCGGCGCCTCG
CCCTTTTCCAGCGCGGCGCGTGGCGCCAAGCCCGATCTGCATGTGCTGGGGGTGGAGGGAATGGCCGCCG
ACGTCACCCAGGGACTGAACGAATTCCAGACGATCCAGTCGGACCAGCAGGCGAAGACCGACAAGGCCCG
CGAGGCGCTGGAAGAGGCGCGCCTCGCCTTTGAGGCGGCGCGCGACGCCGCCGCGACCGTCACCGGAACG
CGCGAAGAGGAGGCCGCCGGACTGACGTCGGAGGAACTCGCCCTGTTCGACGACCCCGGCAGCCCGGTGA
CCTATCCGCTTTACACCGAGGCCCTGGTGGCGTTGCAGACGGCGATCGACAGCGCCGACGTCACCACCGG
CACCGCGGTGGACGCGGCCAAGGCCGCCGCCGCCGGGCTGGACGGGCAGGCGCAAGCGCAGGGCATCATC
CAGCGGCAGACGGCCATGCTGGCGCAATTGGAATCAGAGGGCGCTTCCCGGATGGCGGTCATGGACGACT
ACCGTCGGGTCAAAGGTGCCGACGCCACCGTCTTCCTGGCGGAGCGGGAGGCCGCCTACGCCTACGCCGA
AGCCGCCGCCGGGGTGATGGAGGCGCTGGCGGACCAGGCCGCCATCGATCACGAGACCCTGCGCGCCGCC
CATCGCGAGGCGCTGGATGCCCGTCGGATGCCGTCGAACCTGCCGGACGGCGTCTTTCCCCCGGATGTGA
TCGAGACCTACCGGCAGGCGGGCCAACGCTTGCTGCGCGCCGCCATCGACCTCGTGCCCGACACGGTGGT
GCCGAAGTCGGCGGAGATCGCGGCCGCCAAGACGGCGTATGGCGCGGCGGGCGAGGCGCTGCTGGCGGCG
GTTCCTCCGCGCCGGGTCGGCGCGACGGGCTCGCTCGCCGCCGAGATCAATGCCGCCGAGATGTTCGTCG
ATGCCAAGCTGTCCTGGGCCGAGGCCGGGGCGCGGGCGGCGCGGGCGCGGACCGACGCCGACTCCACCCG
CCGGACCTTCGAGCAGGCGCGCGGCAAGCGTCGGACCGACGCGCCGGTCACGCGGTTCCCACCCAGCCTC
CAGGGAAGCTACGACACCTTCGTCGAGGCCAGCGACACGGTGCTGTCCTCGTCCGATTCATCCGACGCCC
GCGACAGCATGCTGGTCTCCCAGGCGCTGGCCGCCATGGACACCTTGGCCCCCGTCTTTCCCAGCGGGGA
CAATGCGCTGCCCTTCATCATCGCCGCCGAGGTGATGCACTATTCCGGCGTCCTCAGCACCGCCTTCCAG
TATGAGAGGGCGCGGCTGAAGCTTCAGCGGATGGAGCTGGACAGACGGGCGACCGCCGACGCTTTGCAGG
CGCTCGACCGTTTCCAGGCGGGTACCGCCGACCCCTCGGCATCGACGTCCGACATGATGCGGGCCTTGCA
GGAGGCGGCCATCGCCTTGGAGCGCCTGCGCGACCTGTCGCGCAACGCCGCCTGGGCGGCGGCGGCCGAA
GGGGTGGAGACGCTTGCCCAACACAGCGGAGCCACCAGGAGCAGCCTGTCGGGCGAGGCGGGGGGCAGCG
TCTTCACGCGTGGCGGCAAGACCAGTTTCCTCGAGCTTGGTTCCGACAACTCGGTTCATCTTCGGGCCGG
GGAGCGCATCCTGCAAAGCGCCGGCATGATCGCCATCACGGCCAATGGCGACGAAGGGACCGGCAAGGAC
CGCCGGAAGCGGCGCATGGACGAGCGTCGGGACGAGCGTCGGGACGAGTGTCGGGACGAGAGGCGGGCCG
GGATGAGGAACGGAACGGGCAGGTCGGGCAAGGACGACGACACCGTACCGATCACCGAGGCGGTCGGGCA
GGGGCCCGACAGCGCGCCGCCGGCCGCCGCCGCCGGCACCGTGCTGGTCAGTGGCGGGGCCCGGGTGGTG
CTGAGTTCGCAAGGACAGGTGGAGGCCGCCGCCCCGACCGTCACCATCGGCAGCGACAGCCTCAACGCCG
TGGCGACGAAGTCGGTCAGTCTGGGCTGCGCGGCCGACACCGACGCCGCCAAGACGGCCGGAATCGAGAT
CACCCCGAATTCCATCACCTTCACGGTCGGCGACACGACCATCAGCATGACCGAGAGCGGCATAACCCTG
TCCGCCGACAGCATCGCGCTGAACGGCGACGGAGCGGTGAGCCTGGCGTCCGGCGGCGTGATCGTCCTGA
CCTCGCTCAGCACCCAGATCATCGCCGCGCTCGACGTGTCCACCATGGCCACGAACATCAGCAGCATGGG
GGTGATCTGCGAGACCCTGGCGGTGTCGGTCGACACGATGGCCGCCGTCAACGCCTCGACCCTGGCGCCC
TTCGTCACCATCAACTGA