SecReT6
Protein ID: 288960252
SecReT6 ID380
T6SS typei1
Gene symbol-
Locus tagAZL_a05170
StrainAzospirillum sp. B510
Repliconplasmid pAB510a [GenBank: NC_013855] [Browse all T6SS(s) in this replicon]
Location [Strand]642255..644978 [+]
Productchaperone protein
NoteTssH
UniProt IDD3P069
KEGG IDazl:AZL_a05170
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.80E-40, Aligned region: 638..805
AAA_2 [PF07724], Evalue: 1.80E-40, Aligned region: 860..879
AAA [PF00004], Evalue: 1.70E-16, Aligned region: 232..364
AAA [PF00004], Evalue: 1.70E-16, Aligned region: 644..767
AAA_5 [PF07728], Evalue: 1.10E-13, Aligned region: 232..251
AAA_5 [PF07728], Evalue: 1.10E-13, Aligned region: 306..362
AAA_5 [PF07728], Evalue: 1.10E-13, Aligned region: 643..762
ClpB_D2-small [PF10431], Evalue: 1.90E-13, Aligned region: 811..883
AAA_16 [PF13191], Evalue: 7.30E-10, Aligned region: 91..106
AAA_16 [PF13191], Evalue: 7.30E-10, Aligned region: 209..251
AAA_16 [PF13191], Evalue: 7.30E-10, Aligned region: 277..310
AAA_16 [PF13191], Evalue: 7.30E-10, Aligned region: 504..504
AAA_16 [PF13191], Evalue: 7.30E-10, Aligned region: 613..664
AAA_16 [PF13191], Evalue: 7.30E-10, Aligned region: 708..736
Sigma54_activat [PF00158], Evalue: 2.30E-06, Aligned region: 216..246
Sigma54_activat [PF00158], Evalue: 2.30E-06, Aligned region: 643..761
AAA_22 [PF13401], Evalue: 1.00E-05, Aligned region: 231..318
AAA_22 [PF13401], Evalue: 1.00E-05, Aligned region: 349..403
AAA_22 [PF13401], Evalue: 1.00E-05, Aligned region: 641..677
Zeta_toxin [PF06414], Evalue: 8.90E-05, Aligned region: 131..153
Zeta_toxin [PF06414], Evalue: 8.90E-05, Aligned region: 227..252
Zeta_toxin [PF06414], Evalue: 8.90E-05, Aligned region: 628..683
NACHT [PF05729], Evalue: 0.00035, Aligned region: 232..260
NACHT [PF05729], Evalue: 0.00035, Aligned region: 643..670
AAA_25 [PF13481], Evalue: 0.002, Aligned region: 232..270
AAA_25 [PF13481], Evalue: 0.002, Aligned region: 641..665
AAA_25 [PF13481], Evalue: 0.002, Aligned region: 705..727
Arch_ATPase [PF01637], Evalue: 0.002, Aligned region: 211..248
Arch_ATPase [PF01637], Evalue: 0.002, Aligned region: 285..316
Arch_ATPase [PF01637], Evalue: 0.002, Aligned region: 642..683
Clp_N [PF02861], Evalue: 0.0038, Aligned region: 37..75
Clp_N [PF02861], Evalue: 0.0038, Aligned region: 106..130
Protein Sequence: 907 a.a.     [Download]
>gi|288960252|ref|YP_003450592.1| chaperone protein [Azospirillum sp. B510]
MVSVDLQGLISRLHPVCRRSLEAAAGQTLSRTHYNCEIEHWLLQLIGAADGDVCAILRVYEIDAGRLSAD
LTRVLDKLKTGNSRAPALSPALVQLMREAWVLASLQYGEGAIRSGHLLAALLSDDSLSAQARDMSGQFAR
ISAEALRRDLPGIVADTAEARTGAAAAAAAAGGGGAAGGAAKAGGATPNLDQYTIDLTERAKAGGIDPVL
GRDAEIRQIIDVLTRRRQNNPILTGEAGVGKTAVVEGFALRIAAGDVPPDLRNVRLLSLDLGLLQAGAGM
KGEFENRLKGVIDEVKGSSQPIILFIDEAHTLIGAGGQAGQNDAANLLKPALARGEMRTVAATTWAEYKK
YFEKDPALTRRFQVVKVEEPAEPVAVDMMRGLTATLEKHHKVRIVTEGLIEAVRLSSRYIPARQLPDKAV
SLLDTACARVAMSQTATPPAIEDRRRTIQLTGTELAILEREQAIGIDHAEQVAALKDRIAATEADLAALE
ARWTRELELVKTINGTRDQLVAAHERAKAQARGAEGAATAEPPGAEPLDAEPLDAEALTARLSALTAELS
AVQGEDPLVKVAVDGQAVAEVVANWTGVPVGRMVSNEIRTILSLADRMKERIIGQDHALDAIAQAMWTSR
AKLTDPRKPIGVFLMVGTSGVGKTETALTLAELIYGGEQNVTTINMTEYKEEHKVSLLLGSPPGYVGFGE
GGVLTEAVRRRPYSVVLLDELEKAHPGVQDIFFQLFDKGTIKDGEGRDIDFKNTVIIMTSNAGTDLIHKL
CADPETAPDADGLLEALHPELQKSFKPAFLGRCTVIPYFQLSDENLKKIVVLQLNRIARRVARNYKAAFS
YSDDLVQGIVDRCREVSSGARNIETILNRTLLPEMSSRILARMGDGEPITRVHVAVDGEDRFVYDIA
 
Nucleotide Sequence: 2724 bp     [Download]
>gi|288959735|ref|NC_013855.1|:642255-644978 Azospirillum sp. B510 plasmid pAB510a, complete sequence
ATGGTGTCTGTCGATCTTCAGGGCCTGATTTCGCGTCTGCATCCGGTTTGCCGGCGGTCTCTGGAGGCTG
CTGCGGGTCAGACGCTGTCGCGCACGCATTACAATTGCGAGATCGAGCACTGGCTTCTCCAGCTGATCGG
CGCCGCCGACGGTGACGTTTGCGCCATCCTGCGTGTCTACGAGATCGACGCCGGGCGTCTGTCGGCCGAC
CTGACGCGGGTTCTGGACAAGCTGAAGACCGGCAACAGCCGGGCGCCGGCCCTTTCGCCCGCCCTCGTCC
AGCTGATGCGCGAGGCCTGGGTCCTGGCCTCCCTGCAATATGGCGAGGGGGCGATCCGCTCCGGCCATCT
GCTGGCCGCGCTGCTGTCGGACGACTCGCTGTCGGCCCAGGCCCGCGACATGTCGGGCCAGTTCGCCAGG
ATCAGCGCCGAGGCGCTGCGCCGCGACCTGCCCGGGATCGTCGCCGACACGGCGGAGGCGCGGACCGGCG
CCGCGGCCGCCGCGGCCGCGGCCGGAGGCGGTGGCGCCGCGGGCGGTGCCGCGAAGGCCGGCGGGGCGAC
CCCCAACCTCGACCAGTACACCATCGACCTGACCGAGCGGGCGAAGGCCGGCGGGATCGACCCGGTGCTC
GGCCGCGACGCCGAGATCCGCCAGATCATCGACGTGCTGACCCGCCGCCGCCAGAACAACCCGATCCTGA
CCGGCGAGGCCGGCGTCGGCAAGACGGCGGTGGTGGAGGGCTTCGCGCTGCGCATCGCCGCGGGCGACGT
GCCGCCCGACCTGCGCAACGTCCGCCTGCTGTCGCTCGACCTCGGGCTGCTCCAGGCCGGCGCCGGCATG
AAGGGCGAGTTCGAGAACCGGCTGAAGGGCGTGATCGACGAGGTGAAGGGGTCGAGCCAGCCGATCATCC
TGTTCATCGACGAGGCGCACACCCTGATCGGCGCCGGCGGGCAGGCCGGGCAGAACGACGCCGCCAACCT
GCTGAAGCCGGCGCTGGCGCGTGGCGAGATGCGCACCGTCGCCGCCACCACCTGGGCCGAGTACAAGAAA
TATTTCGAGAAGGACCCGGCGCTGACCCGCCGCTTCCAGGTGGTGAAGGTGGAGGAGCCGGCTGAGCCGG
TCGCCGTCGACATGATGCGGGGCCTGACCGCGACGCTGGAGAAGCACCACAAGGTCCGCATCGTGACCGA
GGGGCTGATCGAAGCGGTCCGGCTGTCGAGCCGCTACATCCCGGCGCGCCAGCTTCCCGACAAGGCGGTC
AGCCTGCTCGACACCGCCTGCGCCCGCGTGGCGATGAGCCAGACCGCCACCCCGCCGGCCATCGAGGACC
GCCGCCGCACCATCCAGCTGACCGGGACCGAGCTGGCGATCCTGGAGCGCGAGCAGGCCATCGGCATCGA
CCATGCCGAGCAGGTGGCGGCGCTGAAGGACAGGATCGCCGCCACCGAGGCCGATCTGGCGGCGCTGGAG
GCGCGCTGGACCAGGGAGCTGGAGCTGGTCAAGACGATCAACGGCACGCGCGATCAGCTGGTCGCCGCGC
ACGAGCGGGCGAAGGCGCAGGCGCGGGGCGCCGAGGGCGCCGCCACGGCCGAGCCGCCTGGCGCCGAGCC
GCTCGACGCCGAGCCGCTCGACGCCGAGGCGCTGACCGCCCGGCTTTCGGCGCTGACCGCCGAGCTTTCG
GCGGTGCAGGGCGAGGATCCGCTGGTCAAGGTGGCGGTGGACGGGCAGGCGGTGGCCGAGGTGGTCGCCA
ACTGGACCGGCGTCCCGGTCGGCCGCATGGTGTCGAACGAGATCAGGACCATCCTGTCGCTGGCCGACCG
CATGAAGGAGCGGATCATCGGCCAGGACCATGCGCTGGACGCCATCGCCCAGGCGATGTGGACCAGCCGG
GCCAAGCTGACCGACCCGCGCAAGCCGATCGGCGTCTTCCTGATGGTCGGCACGTCCGGCGTCGGCAAGA
CCGAGACGGCGCTGACGCTGGCCGAGCTGATCTATGGCGGCGAGCAGAACGTCACCACCATCAACATGAC
CGAATACAAGGAGGAGCATAAGGTCTCGCTTCTGCTGGGCTCTCCTCCCGGCTATGTCGGCTTCGGCGAG
GGCGGCGTGCTGACCGAGGCGGTGCGGCGCCGGCCCTACAGCGTCGTGCTGCTGGACGAGCTGGAGAAGG
CCCATCCCGGCGTGCAGGACATCTTCTTCCAGCTGTTCGACAAGGGCACGATCAAGGACGGCGAAGGCCG
CGACATCGACTTCAAGAACACCGTCATCATCATGACGTCGAACGCCGGCACCGACCTGATCCACAAGCTG
TGCGCCGACCCGGAGACCGCGCCGGACGCCGACGGGCTGCTGGAGGCGCTGCATCCGGAGTTGCAGAAGA
GCTTCAAGCCGGCCTTTCTCGGCCGCTGCACCGTCATTCCCTATTTCCAGCTGTCCGACGAGAATCTGAA
GAAGATCGTCGTGCTGCAACTGAACCGCATCGCCCGGCGGGTGGCGCGGAATTACAAGGCGGCCTTCTCC
TATTCCGACGATCTGGTCCAGGGCATCGTCGACCGTTGCCGGGAGGTCTCCAGCGGCGCCCGCAACATCG
AGACCATCCTGAACCGCACGCTTCTGCCGGAGATGTCGTCGCGCATCCTCGCCCGCATGGGCGACGGCGA
GCCGATCACCCGCGTCCATGTCGCCGTCGATGGCGAGGACCGCTTCGTCTACGACATCGCCTGA