SecReT6
Protein ID: 28898166
SecReT6 ID43
T6SS typei1
Gene symbol-
Locus tagVP1392
StrainVibrio parahaemolyticus RIMD 2210633
Repliconchromosome I [GenBank: NC_004603] [Browse all T6SS(s) in this replicon]
Location [Strand]1492844..1495516 [-]
ProductClpA/B-type protease
NoteTssH
UniProt IDQ87PV8
KEGG IDvpa:VP1392
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 5.90E-45, Aligned region: 219..269
AAA_2 [PF07724], Evalue: 5.90E-45, Aligned region: 624..788
AAA [PF00004], Evalue: 1.50E-22, Aligned region: 220..348
AAA [PF00004], Evalue: 1.50E-22, Aligned region: 629..755
AAA_16 [PF13191], Evalue: 7.60E-15, Aligned region: 195..235
AAA_16 [PF13191], Evalue: 7.60E-15, Aligned region: 262..296
AAA_16 [PF13191], Evalue: 7.60E-15, Aligned region: 404..503
AAA_16 [PF13191], Evalue: 7.60E-15, Aligned region: 600..652
AAA_16 [PF13191], Evalue: 7.60E-15, Aligned region: 693..722
AAA_16 [PF13191], Evalue: 7.60E-15, Aligned region: 850..867
ClpB_D2-small [PF10431], Evalue: 3.30E-14, Aligned region: 458..491
ClpB_D2-small [PF10431], Evalue: 3.30E-14, Aligned region: 795..870
AAA_5 [PF07728], Evalue: 1.40E-13, Aligned region: 220..238
AAA_5 [PF07728], Evalue: 1.40E-13, Aligned region: 292..348
AAA_5 [PF07728], Evalue: 1.40E-13, Aligned region: 628..785
AAA_22 [PF13401], Evalue: 8.90E-10, Aligned region: 218..314
AAA_22 [PF13401], Evalue: 8.90E-10, Aligned region: 626..741
Sigma54_activat [PF00158], Evalue: 1.60E-06, Aligned region: 218..276
Sigma54_activat [PF00158], Evalue: 1.60E-06, Aligned region: 433..468
Sigma54_activat [PF00158], Evalue: 1.60E-06, Aligned region: 628..748
AAA_17 [PF13207], Evalue: 4.70E-06, Aligned region: 220..283
AAA_17 [PF13207], Evalue: 4.70E-06, Aligned region: 464..464
AAA_17 [PF13207], Evalue: 4.70E-06, Aligned region: 627..651
AAA_25 [PF13481], Evalue: 1.50E-05, Aligned region: 218..245
AAA_25 [PF13481], Evalue: 1.50E-05, Aligned region: 272..313
AAA_25 [PF13481], Evalue: 1.50E-05, Aligned region: 624..660
IstB_IS21 [PF01695], Evalue: 4.40E-05, Aligned region: 212..240
IstB_IS21 [PF01695], Evalue: 4.40E-05, Aligned region: 628..648
IstB_IS21 [PF01695], Evalue: 4.40E-05, Aligned region: 738..759
Zeta_toxin [PF06414], Evalue: 8.50E-05, Aligned region: 140..169
Zeta_toxin [PF06414], Evalue: 8.50E-05, Aligned region: 218..236
Zeta_toxin [PF06414], Evalue: 8.50E-05, Aligned region: 298..340
Zeta_toxin [PF06414], Evalue: 8.50E-05, Aligned region: 627..668
NACHT [PF05729], Evalue: 9.80E-05, Aligned region: 220..245
NACHT [PF05729], Evalue: 9.80E-05, Aligned region: 277..318
NACHT [PF05729], Evalue: 9.80E-05, Aligned region: 628..653
AAA_19 [PF13245], Evalue: 0.00014, Aligned region: 215..239
AAA_19 [PF13245], Evalue: 0.00014, Aligned region: 625..650
AAA_18 [PF13238], Evalue: 0.00015, Aligned region: 221..240
AAA_18 [PF13238], Evalue: 0.00015, Aligned region: 495..551
AAA_18 [PF13238], Evalue: 0.00015, Aligned region: 629..657
Arch_ATPase [PF01637], Evalue: 0.00067, Aligned region: 198..231
Arch_ATPase [PF01637], Evalue: 0.00067, Aligned region: 270..303
Arch_ATPase [PF01637], Evalue: 0.00067, Aligned region: 627..649
RuvB_N [PF05496], Evalue: 0.00075, Aligned region: 218..235
RuvB_N [PF05496], Evalue: 0.00075, Aligned region: 273..298
RuvB_N [PF05496], Evalue: 0.00075, Aligned region: 580..650
RuvB_N [PF05496], Evalue: 0.00075, Aligned region: 698..721
RNA_helicase [PF00910], Evalue: 0.0028, Aligned region: 220..239
RNA_helicase [PF00910], Evalue: 0.0028, Aligned region: 629..650
RNA_helicase [PF00910], Evalue: 0.0028, Aligned region: 730..747
DUF258 [PF03193], Evalue: 0.0037, Aligned region: 188..236
DUF258 [PF03193], Evalue: 0.0037, Aligned region: 627..649
Protein Sequence: 890 a.a.     [Download]
>gi|28898166|ref|NP_797771.1| ClpA/B-type protease [Vibrio parahaemolyticus RIMD 2210633]
MININLSSLIQRLHPIAKVALEDAAALAVSEKANEVQIEHYLLSLLERPNSDFDVLLSHFDCSENLLRQS
VRSTLDTNAKGNGSKPVFSALLIEWLQESWLVSSLDLSETQIRSGALLLTLVSNPLRYGQHGYASILEAV
NPDSLKRNFAELTSHSIEAQVATSEKTQAREDGSALSKFTTDFTGKARKGEIDPVFCRDQEIRQIVDILA
RRRKNNPIAVGEPGVGKTAVVEGLALKIVQGDVPDNLKGVELYGLDMGLLQAGASVKGEFEKRLNAVLDE
VKNSPTPIILFIDEAHTLVGGGNQAGGSDAANLLKPALARGEVKTIAATTWSEYKKYFEKDPALARRFQL
VKLDEPSPEQAALIIRGLRPAYEKSHNVYVRDDAITAAAALSARYISGRQLPDKAIDVLDTACARVNISL
NAIPASVETLQQELAAQQRELEALERDALQQTGDKHSLANIPDLKLAMETTKEELAEQEVQWHKEKEQIQ
EMIALRSRLHELVFGKVNEEELVVDEDSEQDVSPYTEMDEEAVRIAISACQEQLDAIRNGNPLVHFEVGP
DEVSHVISDWTGIPMGKMLQDEAETTLKLKESLTQSIKGQEYAIDALSEGIQTAKAGLGNPDAPTGVFLL
VGPSGVGKTETARAIADQMFGGERFMTTINMSEFQEKHTVSRLIGSPPGYVGYGEGGMLTEAVRQRPYSV
VLLDEVEKADPEVLNLFYQVFDKGTLNDGEGRTIDFKNTLIIMTSNLATHEIESLVHQSKEIDANIIAEA
IRPTLNQHFKPALLARMSVLPFVPLSDEAMTEIIHHKLNKVSQRLHSHHKLSLSYEESLVEFVLGNCRLA
ETGARNIDAVINRQLLPQLSTQLLVHDKDDSHTQITVSVDEQGTLTYAFS
 
Nucleotide Sequence: 2673 bp     [Download]
>gi|28896774|ref|NC_004603.1|:c1495516-1492844 Vibrio parahaemolyticus RIMD 2210633 chromosome 1, complete sequence
ATGATAAATATAAACCTTTCTTCATTAATTCAGCGTCTACACCCGATAGCTAAAGTAGCATTAGAAGATG
CCGCAGCACTCGCAGTCTCGGAAAAAGCAAACGAAGTTCAAATTGAGCATTATTTACTGAGTCTATTAGA
AAGGCCAAATAGTGATTTTGACGTCTTATTAAGTCATTTTGATTGTTCTGAGAACTTATTGAGACAATCG
GTTCGATCCACACTCGATACCAACGCCAAAGGAAATGGCAGCAAACCTGTTTTTTCTGCTTTATTAATCG
AATGGTTACAAGAAAGCTGGCTGGTTTCTTCTTTAGATCTATCCGAAACACAAATCCGCTCTGGCGCCCT
ACTCCTTACTCTTGTTAGCAACCCTCTGCGTTATGGCCAACATGGTTACGCCTCTATTCTTGAAGCAGTA
AACCCTGATAGCCTTAAACGTAACTTTGCAGAACTAACAAGCCACTCTATTGAGGCGCAAGTCGCGACTT
CAGAGAAAACACAAGCTCGTGAAGATGGTTCAGCACTGAGCAAGTTCACGACAGACTTCACTGGTAAAGC
ACGCAAAGGCGAAATCGATCCTGTTTTCTGCCGTGACCAAGAAATCCGCCAAATTGTAGACATTCTTGCT
CGTCGCCGTAAAAACAACCCTATTGCCGTTGGTGAGCCGGGCGTTGGTAAAACCGCAGTAGTAGAAGGCT
TGGCACTTAAGATTGTACAAGGTGACGTACCAGACAACCTTAAAGGTGTTGAGCTTTACGGCTTGGACAT
GGGTCTTCTGCAAGCTGGCGCAAGCGTAAAAGGCGAATTCGAAAAACGCCTAAATGCAGTATTGGATGAA
GTGAAAAACTCGCCAACACCGATCATCTTGTTCATCGATGAAGCGCACACCCTTGTTGGCGGCGGCAACC
AAGCGGGCGGTAGCGATGCTGCTAACTTATTAAAACCTGCCCTAGCACGTGGTGAAGTAAAGACAATCGC
AGCAACAACATGGTCGGAATACAAAAAGTACTTTGAGAAAGATCCAGCTCTTGCGCGTCGTTTCCAACTG
GTGAAACTCGACGAACCGTCTCCTGAGCAAGCAGCATTGATCATTCGTGGTCTGCGCCCGGCGTACGAGA
AATCTCACAATGTTTACGTACGTGACGACGCTATCACCGCAGCGGCAGCGCTTTCTGCTCGATACATCTC
TGGTCGCCAACTGCCAGACAAAGCGATCGATGTACTAGATACGGCATGTGCACGAGTGAACATCAGCCTT
AATGCCATTCCTGCTTCTGTTGAGACTCTTCAGCAAGAACTTGCAGCTCAACAGCGCGAGCTTGAAGCGC
TTGAGCGTGATGCTCTGCAGCAAACTGGCGACAAGCACAGCCTTGCTAACATTCCAGACCTAAAATTGGC
AATGGAAACGACAAAAGAAGAGCTAGCAGAACAAGAAGTGCAATGGCACAAAGAAAAAGAGCAGATCCAA
GAGATGATTGCTCTACGCTCTCGCTTACATGAACTGGTCTTTGGCAAAGTAAATGAAGAAGAGCTTGTTG
TAGACGAAGATTCAGAACAAGACGTTTCTCCATATACAGAAATGGATGAAGAAGCGGTCCGCATTGCGAT
TTCAGCATGCCAAGAACAGTTAGACGCAATCCGCAATGGCAACCCATTAGTTCACTTTGAAGTTGGGCCA
GATGAAGTCAGCCACGTTATCTCAGACTGGACTGGCATTCCAATGGGTAAGATGCTTCAAGACGAAGCAG
AAACCACGCTAAAACTGAAAGAAAGCCTAACACAAAGCATCAAAGGCCAAGAATACGCTATCGATGCACT
GTCTGAAGGCATTCAAACCGCAAAAGCTGGCTTGGGTAATCCAGACGCACCGACAGGCGTATTCCTGCTA
GTTGGCCCAAGTGGCGTGGGTAAAACCGAAACTGCTCGTGCGATCGCTGATCAAATGTTTGGTGGTGAGC
GCTTTATGACGACCATTAACATGTCTGAGTTCCAAGAGAAGCACACGGTATCTCGCCTAATCGGTTCGCC
TCCTGGTTACGTAGGTTACGGTGAAGGCGGCATGCTGACAGAAGCGGTACGTCAGCGTCCATATTCTGTT
GTACTTCTTGATGAAGTAGAAAAAGCCGATCCAGAAGTGTTGAACCTGTTCTACCAAGTGTTCGACAAAG
GTACGCTGAACGACGGCGAAGGCCGCACCATCGACTTCAAGAACACGCTGATCATCATGACCAGCAACCT
TGCGACGCACGAAATTGAATCTCTGGTTCACCAGTCTAAAGAAATTGATGCTAACATCATCGCAGAAGCC
ATCCGCCCTACTTTGAACCAACACTTCAAGCCGGCGCTGTTGGCACGTATGTCCGTACTTCCGTTTGTGC
CTCTGTCTGACGAAGCAATGACAGAAATTATCCACCACAAACTAAACAAAGTTTCTCAGCGCCTACATAG
CCATCACAAGTTGTCCCTGAGCTACGAAGAAAGCTTGGTCGAGTTCGTACTAGGTAACTGTCGCCTTGCT
GAAACAGGCGCACGTAACATTGACGCGGTCATCAACCGTCAGTTACTACCTCAGCTATCGACACAGCTAT
TGGTGCATGATAAGGATGATTCACACACGCAAATCACAGTTTCTGTCGATGAGCAAGGAACACTGACCTA
TGCGTTCAGCTAA