SecReT6
Protein ID: 28898168
SecReT6 ID43
T6SS typei1
Gene symbol-
Locus tagVP1394
StrainVibrio parahaemolyticus RIMD 2210633
Repliconchromosome I [GenBank: NC_004603] [Browse all T6SS(s) in this replicon]
Location [Strand]1496562..1498640 [+]
ProductVgrG protein
NoteTssI
UniProt IDQ87PV7
KEGG IDvpa:VP1394
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.60E-67, Aligned region: 26..332
Phage_GPD [PF05954], Evalue: 2.60E-67, Aligned region: 501..536
Phage_base_V [PF04717], Evalue: 9.10E-23, Aligned region: 312..332
Phage_base_V [PF04717], Evalue: 9.10E-23, Aligned region: 371..463
Gp5_C [PF06715], Evalue: 1.00E-05, Aligned region: 505..522
Gp5_C [PF06715], Evalue: 1.00E-05, Aligned region: 534..543
Gp5_C [PF06715], Evalue: 1.00E-05, Aligned region: 547..565
Gp5_C [PF06715], Evalue: 1.00E-05, Aligned region: 568..591
Gp5_C [PF06715], Evalue: 1.00E-05, Aligned region: 593..615
Gp5_C [PF06715], Evalue: 1.00E-05, Aligned region: 616..636
Gp5_C [PF06715], Evalue: 1.00E-05, Aligned region: 673..691
DUF2345 [PF10106], Evalue: 0.0045, Aligned region: 493..505
DUF2345 [PF10106], Evalue: 0.0045, Aligned region: 631..689
Protein Sequence: 692 a.a.     [Download]
>gi|28898168|ref|NP_797773.1| VgrG protein [Vibrio parahaemolyticus RIMD 2210633]
MVNDVEFKFEVPGCGHEFRVESFQVNEELSKPFHISLSLLSLDPDISFDSLIRKAGTLTLYGQGLSAARI
FNGVVNEVRYLGTGRRFSRYQLILVPQAWFLSQRQDCRIFQQKSAKDIITEVLDDGSVTDYRFELSGIYP
PKEYALQYRESDLHFVQRMMAEHGMWYYFDHTDSNHTMIIVDSNDAIAPLVSSPLNASYIGPIVYHADSG
GVADREHISDLELVNRVRTGQVTYTDYNYEQPKIPQEMTHAGDLDQDLKQFDYPGRYVDPVMGQVRTTEW
MFEHIVDNQQVEASSDVMRLASGYSFNISDHPRSEINRDYIMLSVMHTGQDPQVHEDEASGMPTTYYNQF
TCIPRDVVFKAPKLAAPVVDGPQTAVVVGPAGEEIYTDKLGRIKVQFHWDRYGNNDEHASCWIRVSQSMA
APTWGAVYLPRIGHEVVVTFLEGDPDRPLVTGAVYNGLHFPPYSLPENKTRTTFRTQTHKGTGYNELSFE
DEANQEEVYIHAQKDMSTKVLNNRYRDIGQDEFLKVARHQTNEVHGDHKETIDGHKTTQVNSTFTETVEQ
DVTVTYNANETQYVKNNSDLEIGDNRTTKIGKNDDLDVGENSNLTVGASKSSDIGADDNQTVGGNLTVSV
KGNTSYKADGATQIISGDKIVLKTGGSSLVMNSDGSIKLSGSSITIEGSDKVVVKGGNVAIN
 
Nucleotide Sequence: 2079 bp     [Download]
>gi|28896774|ref|NC_004603.1|:1496562-1498640 Vibrio parahaemolyticus RIMD 2210633 chromosome 1, complete sequence
ATGGTGAATGACGTAGAATTTAAATTTGAAGTGCCAGGGTGTGGGCACGAGTTTCGGGTAGAAAGCTTTC
AAGTAAATGAAGAGCTTTCGAAACCTTTTCACATCAGTCTCTCATTACTTTCACTTGATCCAGATATCTC
TTTTGATTCGTTAATACGAAAAGCAGGTACACTGACTCTTTATGGACAAGGCTTAAGCGCGGCACGCATA
TTCAATGGTGTGGTGAACGAAGTTCGTTATTTGGGTACAGGCCGTCGCTTCTCTCGCTATCAGTTAATTT
TGGTTCCGCAGGCTTGGTTTTTATCACAGCGCCAAGACTGTCGTATTTTCCAACAAAAATCAGCGAAAGA
TATAATTACAGAGGTGCTTGATGATGGTTCAGTGACCGACTATCGCTTTGAATTGTCTGGTATTTATCCA
CCAAAGGAGTACGCACTGCAATACCGTGAGTCAGACCTACACTTTGTTCAGCGTATGATGGCAGAACACG
GTATGTGGTATTATTTCGACCACACCGATTCAAACCACACAATGATCATTGTCGATAGTAATGATGCCAT
TGCTCCACTGGTTAGCTCTCCTCTCAATGCATCTTATATTGGGCCGATCGTATATCATGCCGATAGTGGG
GGTGTTGCTGACCGTGAGCATATCTCCGATCTCGAGTTAGTTAACCGTGTGAGAACGGGTCAGGTTACTT
ACACTGACTACAACTACGAGCAGCCAAAGATCCCGCAAGAGATGACTCACGCAGGTGATCTGGACCAAGA
TTTAAAGCAGTTTGATTATCCTGGACGTTATGTTGACCCTGTAATGGGGCAGGTGAGAACCACTGAGTGG
ATGTTTGAGCACATTGTCGATAATCAGCAAGTAGAAGCGAGCAGTGATGTGATGCGTTTGGCGTCTGGTT
ACAGCTTTAACATCAGTGACCATCCTCGCTCTGAAATCAACCGTGATTACATCATGTTATCCGTCATGCA
CACAGGGCAAGACCCACAAGTGCACGAAGACGAAGCGAGTGGCATGCCAACTACTTACTACAACCAGTTC
ACGTGTATTCCACGTGATGTTGTATTCAAAGCGCCCAAGTTGGCGGCTCCAGTAGTGGATGGTCCGCAAA
CTGCGGTTGTAGTTGGTCCTGCAGGGGAGGAGATTTACACCGATAAACTAGGACGAATTAAGGTTCAGTT
CCATTGGGATCGCTACGGTAACAACGATGAACATGCAAGTTGCTGGATTCGTGTGAGTCAATCAATGGCT
GCTCCAACGTGGGGTGCGGTTTACTTGCCACGTATTGGTCATGAAGTCGTAGTCACCTTCCTTGAAGGCG
ACCCAGATCGCCCATTGGTGACTGGCGCAGTTTATAACGGTCTTCACTTCCCTCCGTACTCGTTGCCTGA
GAACAAAACTCGTACTACGTTCCGTACGCAAACGCACAAAGGCACCGGCTACAACGAACTGAGTTTTGAA
GACGAAGCGAACCAAGAAGAAGTCTACATTCATGCTCAAAAAGACATGTCGACCAAAGTTCTCAACAATC
GTTACCGAGATATCGGTCAGGATGAGTTCTTAAAGGTTGCGCGTCATCAGACGAACGAAGTCCATGGTGA
TCATAAAGAAACCATTGATGGCCACAAAACAACCCAAGTAAACAGCACTTTTACCGAGACAGTAGAGCAA
GACGTTACCGTTACATACAACGCCAACGAAACCCAATATGTGAAGAACAATTCTGATTTGGAAATTGGAG
ATAACCGCACAACCAAGATCGGCAAGAACGATGATTTGGATGTGGGTGAAAACAGTAACTTAACTGTTGG
TGCATCAAAAAGCTCGGACATTGGTGCCGATGATAACCAAACAGTGGGTGGCAACTTAACCGTATCGGTA
AAAGGCAATACATCTTACAAAGCCGATGGCGCGACGCAGATCATCAGTGGTGACAAGATTGTACTGAAAA
CAGGCGGTTCTTCTTTAGTGATGAACAGTGATGGTTCAATCAAGCTCTCAGGGTCTTCAATCACCATTGA
AGGCAGCGATAAAGTCGTCGTGAAAGGTGGTAACGTAGCGATTAACTAA