SecReT6
Protein ID: 28898175
SecReT6 ID43
T6SS typei1
Gene symbol-
Locus tagVP1401
StrainVibrio parahaemolyticus RIMD 2210633
Repliconchromosome I [GenBank: NC_004603] [Browse all T6SS(s) in this replicon]
Location [Strand]1504684..1506258 [+]
Producthypothetical protein
NoteTssA
UniProt IDQ87PV0
KEGG IDvpa:VP1401
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 4.70E-18, Aligned region: 48..108
Protein Sequence: 524 a.a.     [Download]
>gi|28898175|ref|NP_797780.1| hypothetical protein VP1401 [Vibrio parahaemolyticus RIMD 2210633]
MSVIEIERLLAPISDVNPVGEDARYEFCYEMMESEVKKFGSLFGETVDWSVVKTHATEVLEHHSKDLKAI
CYLVRALTEEFGLQGFEQGLKLLSEALNRFGVELYPSRKRGRDGAVEWLNHQFKLVSSRFAESAQSWDLV
SGCISTIEEVQRQYDDIYQDSEADFFEIRSQLNALSQQAAVDEQSDGAMATIEQTAPLTASQPVAVETPA
QSEVQTVVAKAVPSAPKPAPVKKTVTKEVDVDTDFSSPTASKRTLKKVAEVMIHANPSEPLAYRIYRHLT
WDDIDGLPDHQSNETPLSLAVSSDQQAEYRDKASQESDIDTVKRLERTLTDAPFWLTGHYFVYSMLNNLG
FNDAAFAVKQEVKRFVDSLEGIELLTFKNSIPFADEATLSWLSTQAATSSSAQSVVQTIVITDEDSLPME
DITLANLGEYAAELAHKLELDFSGRGQFMLHLQLIAAYQSVGLYPLCLPYLEKAWEVQQAFNLASWEPHL
SSQLEDLIRKTLHQLFRNKDLLPEQYEKWKAIYD
 
Nucleotide Sequence: 1575 bp     [Download]
>gi|28896774|ref|NC_004603.1|:1504684-1506258 Vibrio parahaemolyticus RIMD 2210633 chromosome 1, complete sequence
ATGTCTGTGATTGAAATTGAACGTTTACTTGCGCCTATCTCTGACGTAAATCCTGTCGGTGAAGATGCTC
GTTACGAGTTTTGTTATGAAATGATGGAATCCGAAGTGAAGAAGTTCGGATCCTTGTTTGGCGAAACGGT
AGATTGGAGTGTCGTAAAAACGCACGCCACTGAAGTTCTTGAACACCACAGCAAAGATTTAAAAGCAATT
TGTTACCTTGTTCGCGCGCTTACAGAAGAGTTTGGTCTGCAAGGTTTCGAGCAAGGTCTAAAGCTGCTTA
GTGAAGCGTTAAATCGCTTTGGCGTTGAGCTGTACCCGTCGCGGAAACGGGGTAGAGATGGTGCGGTAGA
GTGGTTGAACCATCAGTTTAAATTGGTGAGCAGCAGGTTTGCAGAAAGCGCTCAGTCATGGGATTTGGTT
TCAGGTTGTATTTCGACTATCGAAGAAGTCCAACGTCAGTACGACGATATTTACCAAGACTCCGAAGCGG
ACTTCTTTGAAATTCGTAGTCAACTCAATGCGCTATCTCAACAAGCGGCTGTCGATGAGCAAAGCGATGG
TGCAATGGCTACCATCGAACAAACAGCTCCGCTAACGGCTTCACAGCCTGTAGCAGTAGAAACTCCGGCA
CAAAGTGAAGTTCAAACCGTTGTAGCAAAAGCGGTTCCGTCGGCTCCTAAACCTGCACCAGTTAAGAAAA
CAGTAACAAAAGAAGTCGATGTCGATACGGATTTTTCATCGCCGACCGCTTCTAAACGTACACTTAAGAA
AGTTGCGGAAGTTATGATTCATGCGAATCCAAGTGAGCCGCTAGCTTACCGAATTTATCGTCACCTAACT
TGGGATGATATTGATGGTCTTCCTGATCATCAAAGCAATGAAACGCCATTGAGTTTGGCTGTGTCGTCTG
ATCAGCAGGCTGAGTACCGCGATAAAGCCTCTCAAGAAAGCGACATTGATACAGTTAAGCGTTTGGAGCG
CACGTTAACCGATGCTCCGTTTTGGCTGACGGGTCACTACTTTGTTTATTCGATGTTAAACAATCTAGGC
TTTAATGACGCAGCGTTCGCTGTGAAGCAAGAAGTGAAGCGTTTTGTTGATTCATTAGAGGGCATTGAAC
TCCTCACATTTAAGAATTCTATACCATTTGCAGATGAAGCAACGTTGAGCTGGTTATCGACTCAAGCTGC
AACTTCTTCAAGTGCTCAATCTGTCGTTCAAACGATTGTCATCACAGATGAAGACTCACTGCCAATGGAA
GATATCACCCTAGCCAACTTAGGGGAGTATGCCGCAGAACTCGCACACAAACTCGAACTGGATTTCTCGG
GACGTGGGCAGTTTATGCTGCATTTACAATTGATAGCAGCTTACCAGTCTGTTGGATTATACCCGTTGTG
TTTGCCTTACCTTGAAAAAGCTTGGGAAGTGCAACAAGCGTTTAATCTCGCGAGCTGGGAACCCCACTTA
TCGTCACAGTTAGAAGACCTGATTCGAAAAACACTGCATCAGTTATTCAGAAACAAGGATCTTTTGCCTG
AACAGTACGAAAAGTGGAAAGCAATTTATGACTAA